(data stored in ACNUC7421 zone)

EMBL: CP000948.ECFK

CP000948.ECFK        Location/Qualifiers
FT   CDS_pept        172032..174464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecfK"
FT                   /locus_tag="ECDH10B_0157"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01355"
FT                   /db_xref="GOA:B1XD46"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XD46"
FT                   /protein_id="ACB01355.1"
FT                   /translation="MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLS
FT                   MPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKS
FT                   VKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRV
FT                   DLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGD
FT                   LETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHS
FT                   AEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVN
FT                   VDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVD
FT                   TDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGI
FT                   NGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGF
FT                   PINEYNSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGW
FT                   TYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRW
FT                   GYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQD
FT                   GAKDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQ
FT                   YSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW"
     atggcgatga aaaagttgct catagcgtcg ctgctgttta gcagcgccac cgtatacggt        60
     gctgaagggt tcgtagtgaa agatattcat ttcgaaggcc ttcagcgtgt cgccgttggt       120
     gcggccctcc tcagtatgcc ggtgcgcaca ggcgacacgg ttaatgatga agatatcagt       180
     aataccattc gcgctctgtt tgctaccggc aactttgagg atgttcgcgt ccttcgtgat       240
     ggtgataccc ttctggttca ggtaaaagaa cgtccgacca ttgccagcat tactttctcc       300
     ggtaacaaat cggtgaaaga tgacatgctg aagcaaaacc tcgaggcttc tggtgtgcgt       360
     gtgggcgaat ccctcgatcg caccaccatt gccgatatcg agaaaggtct ggaagacttc       420
     tactacagcg tcggtaaata tagcgccagc gtaaaagctg tcgtgacccc gctgccgcgc       480
     aaccgtgttg acctaaaact ggtgttccag gaaggtgtgt cagctgaaat ccagcaaatt       540
     aacattgttg gtaaccatgc tttcaccacc gacgaactga tctctcattt ccaactgcgt       600
     gacgaagtgc cgtggtggaa cgtggtaggc gatcgtaaat accagaaaca gaaactggcg       660
     ggcgaccttg aaaccctgcg cagctactat ctggatcgcg gttatgcccg tttcaacatc       720
     gactctaccc aggtcagtct gacgccagat aaaaaaggta tttacgtcac ggtgaacatc       780
     accgaaggcg atcagtacaa gctttctggc gttgaagtga gcggcaacct tgccgggcac       840
     tccgctgaaa ttgagcagct gactaagatc gagccgggtg agctgtataa cggcaccaaa       900
     gtgaccaaga tggaagatga catcaaaaag cttctcggtc gctatggtta tgcctatccg       960
     cgcgtacagt cgatgcccga aattaacgat gccgacaaaa ccgttaaatt acgtgtgaac      1020
     gttgatgcgg gtaaccgttt ctacgtgcgt aagatccgtt ttgaaggtaa cgatacctcg      1080
     aaagatgccg tcctgcgtcg cgaaatgcgt cagatggaag gtgcatggct ggggagcgat      1140
     ctggtcgatc agggtaagga gcgtctgaat cgtctgggct tctttgaaac tgtcgatacc      1200
     gatacccaac gtgttccggg tagcccggac caggttgatg tcgtctacaa ggtaaaagag      1260
     cgcaacaccg gtagcttcaa ctttggtatt ggttacggta ctgaaagtgg cgtgagcttc      1320
     caggctggtg tgcagcagga taactggtta ggtacaggtt atgctgttgg tatcaacggg      1380
     accaaaaacg attaccagac ctatgctgaa ctgtcggtaa ccaacccgta cttcaccgta      1440
     gatggcgtaa gcctcggtgg tcgtctcttc tataatgact tccaggcaga tgacgccgac      1500
     ctgtccgact ataccaacaa gagttatggt acagacgtga cgttgggctt cccgattaac      1560
     gaatataact cgctgcgtgc aggtctgggt tatgtacata actccctgtc caacatgcag      1620
     cctcaggttg cgatgtggcg ttatctgtac tctatgggtg aacatccgag cacctctgat      1680
     caggataaca gcttcaaaac ggacgacttc acgttcaact atggttggac ctataacaag      1740
     cttgaccgtg gttacttccc gacagatggt tcacgtgtca acctgaccgg taaagtgacc      1800
     attcctggat cggataacga atactacaaa gtgacgttag acacggcgac ttatgtgccg      1860
     atcgatgacg atcacaaatg ggttgttctg gggcgtaccc gctggggtta tggtgatggt      1920
     ttaggcggca aagagatgcc gttctacgag aacttctatg ccggtggttc cagcaccgtg      1980
     cgtggcttcc agtccaatac cattggtccg aaagcagttt acttcccgca tcaggccagt      2040
     aattatgatc cggactatga ttacgaatgt gcgactcagg acggcgcgaa agacctgtgt      2100
     aaatcggatg atgctgtagg cggtaacgcc atggcggttg ccagcctcga gttcatcacc      2160
     ccgacgccgt ttattagcga taagtatgct aactcggttc gtacttcctt cttctgggat      2220
     atgggtaccg tttgggatac aaactgggat tccagccaat attctggata tccggactat      2280
     agtgatccaa gcaatatccg tatgtctgcg ggtatcgcat tacaatggat gtccccattg      2340
     gggccgttgg tgttctccta cgcccagccg ttcaaaaagt acgatggaga caaggcagaa      2400
     cagttccagt ttaacatcgg taaaacctgg taa                                   2433
//

If you have problems or comments...

PBIL Back to PBIL home page