(data stored in ACNUC7421 zone)

EMBL: CP000948.EMRE

CP000948.EMRE        Location/Qualifiers
FT   CDS_pept        506870..507202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emrE"
FT                   /locus_tag="ECDH10B_0499"
FT                   /product="DLP12 prophage; multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01666"
FT                   /protein_id="ACB01666.1"
FT                   /translation="MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFW
FT                   LLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLL
FT                   SRSTPH"
     atgaaccctt atatttatct tggtggtgca atacttgcag aggtcattgg tacaacctta        60
     atgaagtttt cagaaggttt tacacggtta tggccatctg ttggtacaat tatttgttat       120
     tgtgcatcat tctggttatt agctcagacg ctggcttata ttcctacagg gattgcttat       180
     gctatctggt caggagtcgg tattgtcctg attagcttac tgtcatgggg atttttcggc       240
     caacggctgg acctgccagc cattataggc atgatgttga tttgtgccgg tgtgttgatt       300
     attaatttat tgtcacgaag cacaccacat taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page