(data stored in ACNUC7421 zone)

EMBL: CP000948.ESSD

CP000948.ESSD        Location/Qualifiers
FT   CDS_pept        515953..516168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="essD"
FT                   /locus_tag="ECDH10B_0511"
FT                   /product="DLP12 prophage; predicted phage lysis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01677"
FT                   /protein_id="ACB01677.1"
FT                   /translation="MKSMDKLTTGVAYGTSAGSAGYWFLQLLDKVTPSQWAAIGVLGSL
FT                   VFGLLTYLTNLYFKIKEDKRKAARGE"
     atgaaatcca tggataagtt aacaacgggt gtcgcctatg gcacctcagc aggtagtgcc        60
     gggtactggt ttttacagct gctagataaa gtcactccct cacagtgggc agcaataggt       120
     gtgctgggta gcctggtatt tggcctgctg acgtacctga caaaccttta tttcaagatt       180
     aaagaagata agcgcaaggc tgcgagaggt gaataa                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page