(data stored in ACNUC7421 zone)

EMBL: CP000948.FDRA

CP000948.FDRA        Location/Qualifiers
FT   CDS_pept        485235..486902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdrA"
FT                   /locus_tag="ECDH10B_0474"
FT                   /product="predicted acyl-CoA synthetase with NAD(P)-binding
FT                   Rossmann-fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01643"
FT                   /protein_id="ACB01643.1"
FT                   /translation="MIHAFIKKGCFQDSVSLMIISRKLSESENVDDVSVMMGTPANKAL
FT                   LDTTGFWHDDFNNATPNDICVAIRSEAADAGIAQAIMQQLEEALKQLAQGSGSSQALTQ
FT                   VRRWDSACQKLPDANLALISVAGEYAAELANQALDRNLNVMMFSDNVTLEDEIQLKTRA
FT                   REKGLLVMGPDCGTSMIAGTPLAFANVMPEGNIGVIGASGTGIQELCSQIALAGEGITH
FT                   AIGLGGRDLSREVGGISALTALEMLSADEKSEVLAFVSKPPAEAVRLKIVNAMKATGKP
FT                   TVALFLGYTPAVARDENVWFASSLDEAARLACLLSRVTARRNAIAPVSSGFICGLYTGG
FT                   TLAAEAAGLLAGHLGVEADDTHQHGMMLDADSHQIIDLGDDFYTVGRPHPMIDPTLRNQ
FT                   LIADLGAKPQVRVLLLDVVIGFGATADPAASLVSAWQKACAARLDNQPLYAIATVTGTE
FT                   RDPQCRSQQIATLEDAGIAVVSSLPEATLLAAALIHPLSPAAQQHTPSLLENVAVINIG
FT                   LRSFALELQSASKPVVHYQWSPVAGGNKKLARLLERLQ"
     atgatccacg cctttattaa aaaagggtgt tttcaggatt cggtcagttt aatgattatt        60
     tcacgaaaac tcagcgaatc agaaaatgtt gatgatgttt ccgtaatgat gggtacgccc       120
     gccaataaag cgttattaga taccacaggt ttctggcatg acgattttaa taacgccacg       180
     ccgaacgata tttgcgtggc aattcgtagc gaagcggcgg atgcggggat cgcgcaggcg       240
     attatgcagc agcttgaaga ggcgctaaaa caactggcgc aggggtcagg cagcagccag       300
     gcgttgacgc aggtgcgtcg ctgggacagt gcctgtcaga aattacccga tgccaatctg       360
     gcgctgattt cagtggctgg cgagtatgcg gcggagctgg caaaccaggc gctggatcgc       420
     aacctcaacg tgatgatgtt ctccgataac gtcacgctgg aagatgaaat ccaacttaaa       480
     acccgcgcgc gggaaaaagg cttgctggtg atggggccgg actgcggtac gtcgatgatt       540
     gccggcacac cgctggcttt tgctaacgtg atgccggaag gcaatattgg cgtcattggc       600
     gcttccggta ccgggattca ggagctgtgt tcgcagattg cgctggcagg ggagggaatt       660
     actcacgcga ttggccttgg cgggcgcgac ctcagccgtg aagtgggcgg catcagtgcg       720
     ctaacagcgc tggaaatgct cagtgcagac gagaaaagcg aagtgctggc atttgtttca       780
     aaaccacctg ccgaagctgt gcgtctgaaa attgttaatg ccatgaaagc aaccggcaaa       840
     ccgacggtgg cgctgttttt aggttatacc ccggcggtgg cccgcgacga gaatgtctgg       900
     tttgcctcct cgctggatga ggccgcacgc ctggcttgcc tgctttcacg cgtcacggcg       960
     cgacgtaacg caatagcgcc tgtcagcagc ggatttattt gcggtttgta taccggcggt      1020
     acgctggctg ccgaagcggc gggattactt gccggacacc ttggcgtgga agccgacgat      1080
     acccatcaac atggcatgat gctggacgcc gatagccacc agattattga cctcggcgat      1140
     gatttctaca ccgtcgggcg tccccatccg atgatcgacc caaccttacg caaccagtta      1200
     attgccgatc tcggcgctaa accgcaagtg cgcgtgttgc tgcttgatgt cgtgattggc      1260
     ttcggtgcga ccgccgatcc tgccgcctcg ctggtgagcg cctggcaaaa agcctgtgcc      1320
     gcgcgtttag ataatcaacc actgtatgcc attgccacgg tgacaggcac tgaacgtgac      1380
     ccgcaatgcc gctcgcagca aatcgccacg ctggaagatg cggggattgc ggtcgtgagt      1440
     tcgctaccgg aagccacctt gctggcggca gcgttaattc atccgctctc gcctgccgca      1500
     cagcaacaca caccgtcatt actggaaaac gtcgccgtga ttaacatcgg attacgcagc      1560
     tttgcgctgg agctacaaag cgccagcaaa ccggttgtgc attaccaatg gtcgccagtc      1620
     gccggtggca ataaaaaact ggctcgttta ttagaacgtt tgcaataa                   1668
//

If you have problems or comments...

PBIL Back to PBIL home page