(data stored in ACNUC7421 zone)

EMBL: CP000948.FHUA

CP000948.FHUA        Location/Qualifiers
FT   CDS_pept        141588..143831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="ECDH10B_0130"
FT                   /product="ferrichrome outer membrane transporter"
FT                   /note="the ambiguity code R at position 761 of the gene
FT                   reflects a mixed population; the wild-type sequence has a
FT                   G, while the fhu amber mutant has an A and results in a
FT                   T1-resistance phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01329"
FT                   /protein_id="ACB01329.1"
FT                   /translation="MARSKTAQPKHSLRKIAVVVATAVSGMSVYAQAAVEPKEDTITVT
FT                   AAPAPQESAWGPAATIAARQSATGTKTDTPIQKVPQSISVVTAEEMALHQPKSVKEALS
FT                   YTPGVSVGTRGASNTYDHLIIRGFAAEGQSQNNYLNGLKLQGNFYNDAVIDPYMLERAE
FT                   IMRGPVSVLYGKSSPGGLLNMVSKRPTTEPLKEVQFKAGTDSLFQTGFDFSDSLDDDGV
FT                   YSYRLTGLARSANAQQKGSEEQRYAIAPAFTXRPDDKTNFTFLSYFQNEPETGYYGWLP
FT                   KEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRFAENKT
FT                   SQNSVYGYGVCSDPANAYSKQCAALAPADKGHYLARKYVVDDEKLQNFSVDTQLQSKFA
FT                   TGDIDHTLLTGVDFMRMRNDINAWFGYDDSVPLLNLYNPVNTDFDFNAKDPANSGPYRI
FT                   LNKQKQTGVYVQDQAQWDKVLVTLGGRYDWADQESLNRVAGTTDKRDDKQFTWRGGVNY
FT                   LFDNGVTPYFSYSESFEPSSQVGKDGNIFAPSKGKQYEVGVKYVPEDRPIVVTGAVYNL
FT                   TKTNNLMADPEGSFFSVEGGEIRARGVEIEAKAALSASVNVVGSYTYTDAEYTTDTTYK
FT                   GNTPAQVPKHMASLWADYTFFDGPLSGLTLGTGGRYTGSSYGDPANSFKVGSYTVVDAL
FT                   VRYDLARVGMAGSNVALHVNNLFDREYVASCFNTYGCFWGAERQVVATATFRF"
     atggcgcgtt ccaaaactgc tcagccaaaa cactcactgc gtaaaatcgc agttgtagta        60
     gccacagcgg ttagcggcat gtctgtttat gcacaggcag cggttgaacc gaaagaagac       120
     actatcaccg ttaccgctgc acctgcgccg caagaaagcg catgggggcc tgctgcaact       180
     attgcggcgc gacagtctgc taccggcact aaaaccgata cgccgattca aaaagtgcca       240
     cagtctattt ctgttgtgac cgccgaagag atggcgctgc atcagccgaa gtcggtaaaa       300
     gaagcgctta gctacacgcc gggtgtctct gttggtacgc gtggcgcatc caacacctat       360
     gaccacctga tcattcgcgg ctttgcggca gaaggccaaa gccagaataa ctatctgaat       420
     ggcctgaagt tgcagggcaa cttctataac gatgcggtca ttgacccgta tatgctggaa       480
     cgcgctgaaa ttatgcgtgg cccggtttcc gtgctttacg gtaaaagcag tcctggcggc       540
     ctgttgaata tggtcagcaa gcgtccgacc accgaaccgc tgaaagaagt tcagtttaaa       600
     gccggtactg acagcctgtt ccagactggt tttgacttta gcgattcgtt ggatgatgac       660
     ggtgtttact cttatcgcct gaccggtctt gcgcgttctg ccaatgccca gcagaaaggg       720
     tcagaagagc agcgttatgc tattgcaccg gcgttcacct rgcgtccgga tgataaaacc       780
     aattttacct tcctttctta cttccagaac gagccggaaa ccggttatta cggctggttg       840
     ccgaaagagg gaaccgttga gccgctgccg aacggtaagc gtctgccgac agactttaat       900
     gaaggggcga agaacaacac ctattctcgt aatgagaaga tggtcggcta cagcttcgat       960
     cacgaattta acgacacctt tactgtgcgt cagaacctgc gctttgctga aaacaaaacc      1020
     tcgcaaaaca gcgtttatgg ttacggcgtc tgctccgatc cggcgaatgc ttacagcaaa      1080
     cagtgtgcgg cattagcgcc agcggataaa ggccattatc tggcacgtaa atacgtcgtt      1140
     gatgatgaga agctgcaaaa cttctccgtt gatacccagt tgcagagcaa gtttgccact      1200
     ggcgatatcg accacaccct gctgaccggt gtcgacttta tgcgtatgcg taatgacatc      1260
     aacgcctggt ttggttacga cgactctgtg ccactgctca atctgtacaa tccggtgaat      1320
     accgatttcg acttcaatgc caaagatccg gcaaactccg gcccttaccg cattctgaat      1380
     aaacagaaac aaacgggcgt ttatgttcag gatcaggcgc agtgggataa agtgctggtc      1440
     accctaggcg gtcgttatga ctgggcagat caagaatctc ttaaccgcgt tgccgggacg      1500
     accgataaac gtgatgacaa acagtttacc tggcgtggtg gtgttaacta cctgtttgat      1560
     aatggtgtaa caccttactt cagctatagc gaatcgtttg aaccttcttc gcaagttggg      1620
     aaggatggta atattttcgc accgtctaaa ggtaagcagt atgaagtcgg cgtgaaatat      1680
     gtaccggaag atcgtccgat tgtagttact ggtgccgtgt ataatctcac taaaaccaac      1740
     aacctgatgg cggaccctga gggttccttc ttctcggttg aaggtggcga gatccgcgca      1800
     cgtggcgtag aaatcgaagc gaaagcggcg ctgtcggcga gtgttaacgt agtcggttct      1860
     tatacttaca ccgatgcgga atacaccacc gatactacct ataaaggcaa tacgcctgca      1920
     caggtgccaa aacacatggc ttcgttgtgg gctgactaca ccttctttga cggtccgctt      1980
     tcaggtctga cgctgggcac cggtggtcgt tatactggct ccagttatgg tgatccggct      2040
     aactccttta aagtgggaag ttatacggtc gtggatgcgt tagtacgtta tgatctggcg      2100
     cgagtcggca tggctggctc caacgtggcg ctgcatgtta acaacctgtt cgatcgtgaa      2160
     tacgtcgcca gctgctttaa cacttatggc tgcttctggg gcgcagaacg tcaggtcgtt      2220
     gcaaccgcaa ccttccgttt ctaa                                             2244
//

If you have problems or comments...

PBIL Back to PBIL home page