(data stored in ACNUC7421 zone)

EMBL: CP000948.FHUD

CP000948.FHUD        Location/Qualifiers
FT   CDS_pept        144679..145569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="ECDH10B_0132"
FT                   /product="iron-hydroxamate transporter subunit;
FT                   periplasmic-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01331"
FT                   /protein_id="ACB01331.1"
FT                   /translation="MSGLPLISRRRLLTAMALSPLLWQMNTAHAAAIDPNRIVALEWLP
FT                   VELLLALGIVPYGVADTINYRLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSA
FT                   GYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLAQYEDFIR
FT                   SMKPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAV
FT                   SIDRLAAYKDVDVLCFDHDNSKDMDALMATPLWQAMPFVRAGRFQRVPAVWFYGATLSA
FT                   MHFVRVLDNAIGGKA"
     atgagcggct tacctcttat ttcgcgccgt cgactgttaa cggcgatggc gctttctccg        60
     ttgttatggc agatgaatac cgcccacgcg gcggctattg atcccaatcg tattgtggcg       120
     ctggagtggt tgccggtgga attactgctg gcgctcggca tcgtgcctta cggcgtggcg       180
     gataccatca actatcgcct gtgggtcagc gaaccaccat tgccggactc agtgatcgac       240
     gtcggtttgc gcacagaacc taaccttgaa ctgctgaccg aaatgaaacc atcgtttatg       300
     gtctggtcgg caggatatgg cccttcacca gaaatgctgg ctcgtattgc gccgggtcgc       360
     ggatttaact tcagtgacgg caaacagccg ttggcgatgg cgcgtaaatc gctgacggaa       420
     atggcagatt tacttaacct gcaaagcgca gcggaaacgc atttagcgca atatgaagac       480
     tttatccgca gcatgaaacc ccgctttgtg aagcgtggtg cgcgtccgtt attgctgacg       540
     acgcttatcg atccgcgcca tatgctggtc ttcggtccaa acagcttgtt ccaggaaatt       600
     cttgatgagt acggcatccc aaatgcctgg caaggggaaa ccaacttctg gggcagtacc       660
     gccgtcagta tcgatcgtct ggcggcgtat aaagacgttg atgtgctctg ttttgatcac       720
     gacaacagca aagacatgga tgcgctaatg gcaacgccgc tgtggcaggc catgccgttt       780
     gtccgcgccg gacgctttca gcgcgtacct gcagtctggt tttatggtgc gacgctctcg       840
     gcaatgcact ttgtgcgcgt tctggataac gccatcggag gtaaagcgtg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page