(data stored in ACNUC7421 zone)

EMBL: CP000948.FTSQ

CP000948.FTSQ        Location/Qualifiers
FT   CDS_pept        77259..78089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="ECDH10B_0075"
FT                   /product="membrane anchored protein involved in growth of
FT                   wall at septum"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01274"
FT                   /protein_id="ACB01274.1"
FT                   /translation="MSQAALNTRNSEEEVSSRRNNGTRLAGILFLLTVLTTVLVSGWVV
FT                   LGWMEDAQRLPLSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLP
FT                   WIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPERTSKQVLPMLYGP
FT                   EGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLAR
FT                   FVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESTQQQNQAQAEQQ"
     atgtcgcagg ctgctctgaa cacgcgaaac agcgaagaag aggtttcttc tcgccgcaat        60
     aatggaacgc gtctggcggg gatccttttc ctgctgaccg ttttaacgac agtgttggtg       120
     agcggctggg tcgtgttggg ctggatggaa gatgcgcaac gcctgccgct ctcaaagctg       180
     gtgttgaccg gtgaacgcca ttacacacgt aatgacgata tccggcagtc gatcctggca       240
     ttgggtgagc cgggtacctt tatgacccag gatgtcaaca tcatccagac gcaaatagaa       300
     caacgcctgc cgtggattaa gcaggtgagc gtcagaaagc agtggcctga tgaattgaag       360
     attcatctgg ttgaatatgt gccgattgcg cggtggaatg atcaacatat ggtagacgcg       420
     gaaggaaata ccttcagcgt gccgccagaa cgcaccagca agcaggtgct tccaatgctg       480
     tatggcccgg aaggcagcgc caatgaagtg ttgcagggct atcgcgaaat ggggcagatg       540
     ctggcaaagg acagatttac tctgaaggaa gcggcgatga ccgcgcggcg ttcctggcag       600
     ttgacgctga ataacgatat taagctcaat cttggccggg gcgatacgat gaaacgtttg       660
     gctcgctttg tagaacttta tccggtttta cagcagcagg cgcaaaccga tggcaaacgg       720
     attagctacg ttgatttgcg ttatgactct ggagcggcag taggctgggc gcccttgccg       780
     ccagaggaat ctactcagca acaaaatcag gcacaggcag aacaacaatg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page