(data stored in ACNUC7421 zone)

EMBL: CP000948.GLND

CP000948.GLND        Location/Qualifiers
FT   CDS_pept        complement(160082..162754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="ECDH10B_0146"
FT                   /product="uridylyltransferase/uridylyl-removing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01345"
FT                   /db_xref="GOA:B1XD36"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XD36"
FT                   /protein_id="ACB01345.1"
FT                   /translation="MNTLPEQYANTALPTLPGQPQNPCVWPRDELTVGGIKAHIDTFQR
FT                   WLGDAFDNGISAEQLIEARTEFIDQLLQRLWIEAGFSQIADLALVAVGGYGRGELHPLS
FT                   DVDLLILSRKKLPDDQAQKVGELLTLLWDVKLEVGHSVRTLEECMLEGLSDLTVATNLI
FT                   ESRLLIGDVALFLELQKHIFSEGFWPSDKFYAAKVEEQNQRHQRYHGTSYNLEPDIKSS
FT                   PGGLRDIHTLQWVARRHFGATSLDEMVGFGFLTSAERAELNECLHILWRIRFALHLVVS
FT                   RYDNRLLFDRQLSVAQRLNYSGEGNEPVERMMKDYFRVTRRVSELNQMLLQLFDEAILA
FT                   LPADEKPRPIDDEFQLRGTLIDLRDETLFMRQPEAILRMFYTMVHNSAITGIYSTTLRQ
FT                   LRHARRHLQQPLCNIPEARKLFLSILRHPGAVRRGLLPMHRHSVLGAYMPQWSHIVGQM
FT                   QFDLFHAYTVDEHTIRVMLKLESFASEETRQRHPLCVDVWPRLPSTELIFIAALFHDIA
FT                   KGRGGDHSILGAQDVVHFAELHGLNSRETQLVAWLVRQHLLMSVTAQRRDIQDPEVIKQ
FT                   FAEEVQTENRLRYLVCLTVADICATNETLWNSWKQSLLRELYFATEKQLRRGMQNTPDM
FT                   RERVRHHQLQALALLRMDNIDEEALHQIWSRCRANYFVRHSPNQLAWHARHLLQHDLSK
FT                   PLVLLSPQATRGGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDAQIFTTRDGMAMDTFI
FT                   VLEPDGNPLSADRHEVIRFGLEQVLTQSSWQPPQPRRQPAKLRHFTVETEVTFLPTHTD
FT                   RKSFLELIALDQPGLLARVGKIFADLGISLHGARITTIGERVEDLFIIATADRRALNNE
FT                   LQQEVHQRLTEALNPNDKG"
     atgaataccc ttccagaaca gtacgcaaac accgctctcc ccaccctgcc cggtcaaccg        60
     caaaatccat gcgtctggcc ccgtgatgaa ttaaccgtcg gtgggataaa agcccatatc       120
     gatactttcc agcgttggct gggtgatgcc tttgacaatg ggatctctgc agaacagttg       180
     attgaggcgc gcaccgagtt tatcgaccag ctcctgcaac gattatggat tgaagcggga       240
     ttcagccaga ttgccgacct ggcattggtc gccgtcggtg gctacggtcg tggcgagctg       300
     catccacttt cagacgtcga tttactgatt ttaagccgta aaaagctccc ggacgatcag       360
     gcgcaaaaag tgggcgagct gttaacgctg ctctgggatg taaagctgga agtcggtcat       420
     agcgtgcgca cgcttgaaga gtgcatgctg gaagggttat cggatttaac cgtcgccacc       480
     aatttaatcg aatcccgctt attaattggc gatgttgcgc tgttcctcga actgcaaaaa       540
     catattttca gcgaaggatt ctggccttcc gacaagttct acgcggcgaa agttgaagaa       600
     cagaaccagc gccatcagcg ttaccatggc accagctaca accttgaacc agacatcaaa       660
     agcagccctg gcggcttgcg cgatatccac actctgcaat gggtggcccg ccgtcatttt       720
     ggcgcaacat cgctggatga aatggtcggg tttggcttct taacctcagc ggagcgggcg       780
     gaattaaacg aatgtctgca tatattgtgg cgtattcgct ttgccctgca tctggtcgtc       840
     agccgttacg ataatcgcct gttattcgat cgccagctta gcgtcgccca gcgtctgaat       900
     tacagtggtg aaggtaacga accggtcgag cggatgatga aggattactt ccgcgttaca       960
     cgccgcgtca gtgaactcaa ccagatgctg ctgcaactgt tcgatgaagc catcctcgcc      1020
     cttcccgccg acgaaaaacc acgtccaatc gacgatgagt ttcagctacg cggtacgcta      1080
     atcgacctgc gtgatgaaac actatttatg cgccagccgg aagccatctt gcgtatgttc      1140
     tacaccatgg tgcacaacag tgcgatcacc ggcatttact ccaccacgct gcgccagtta      1200
     cgccatgccc gtcgccatct gcaacaaccg ctgtgtaata ttccggaagc acgaaaactg      1260
     tttttgagca ttctgcgtca ccccggagcg gtgcggcgcg ggctattgcc aatgcatcgc      1320
     catagcgtgc tcggcgcgta tatgccgcaa tggtcgcata tcgtcgggca gatgcagttt      1380
     gatctgttcc acgcctacac ggtggatgaa catactatcc gcgtgatgct gaaactggag      1440
     agttttgcca gtgaagaaac gcgccagcgc catccgttgt gtgtggacgt ctggccgcgc      1500
     ctgccgtcaa ctgagctgat tttcatcgcc gcgctgtttc acgatatcgc caaaggacgc      1560
     ggcggcgacc actccattct cggtgctcag gatgtagtgc attttgccga actccacggg      1620
     ctgaactcac gcgaaacaca gctggtcgcc tggctggttc gccagcacct gttgatgtcg      1680
     gtgaccgccc aacgccgcga tattcaggac ccggaagtca tcaagcagtt tgccgaagaa      1740
     gtgcaaacgg aaaatcgtct gcgctatctg gtatgcctga ctgtggctga catttgcgcc      1800
     accaacgaaa cgctgtggaa tagctggaag caaagtctgt tgcgtgagct ctactttgcc      1860
     accgaaaagc agctacgacg cggaatgcaa aacacgccgg atatgcgcga acgggttcgc      1920
     catcaccaac tccaggcact ggcactactg cgcatggata acatcgacga agaggcgctg      1980
     caccaaattt ggtcacgctg tcgtgctaac tattttgtcc gccatagccc aaatcaactg      2040
     gcctggcatg cccgccattt attacagcat gatttaagca aaccgctggt attgcttagc      2100
     ccgcaggcta cgcgtggagg caccgagatt tttatctgga gcccggaccg cccttatctg      2160
     tttgccgccg tctgtgccga attagaccgc cgcaatttaa gtgttcacga cgcacaaatt      2220
     ttcaccactc gcgacggtat ggcgatggat acctttatcg tgctggaacc cgatggcaac      2280
     ccgctgtccg cagatcgtca tgaggttatt cggtttggtc tggagcaagt actgacgcaa      2340
     agtagctggc agccaccgca gccccgtcgc caacccgcca aattacgcca ttttactgtt      2400
     gaaaccgaag taacgttttt gccgacccat accgaccgca aatcgttcct cgaactgatc      2460
     gccctcgacc aacctggact gctggcgcga gtcgggaaaa tttttgccga tctgggaatt      2520
     tcgcttcatg gtgcccgaat tacaaccatt ggcgagcgag tagaagattt attcataatt      2580
     gccaccgctg accggcgtgc gcttaataac gagttgcagc aggaagtgca tcagcggttg      2640
     acagaggccc tcaatccaaa cgataaaggg tga                                   2673
//

If you have problems or comments...

PBIL Back to PBIL home page