(data stored in ACNUC7421 zone)

EMBL: CP000948.GLXK

CP000948.GLXK        Location/Qualifiers
FT   CDS_pept        480443..481588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /locus_tag="ECDH10B_0470"
FT                   /product="glycerate kinase II"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01639"
FT                   /protein_id="ACB01639.1"
FT                   /translation="MKIVIAPDSFKESLSAEKCCQAIKAGFSTLFPDANYICLPIADGG
FT                   EGTVDAMVAATGGNIVTLEVCGPMGEKVNAFYGLTGDGKTAVIEMAAASGLMLVAPEKR
FT                   NPLLASSFGTGELIRHALDNDIRHIILGIGGSATVDGGMGMAQALGVRFLDADGQALAA
FT                   NGGNLARVASIEMDECDPRLANCHIEVACDVDNPLVGARGAAAVFGPQKGATPEMVEEL
FT                   EQGLQNYARVLQQQTEINVCQMAGGGAAGGMGIAAAVFLNADIKPGIEIVLNAVNLAQA
FT                   VQGAALVITGEGRIDSQTAGGKAPLGVASVAKQFNVPVIGIAGVLGDGVEVVHQYGIDA
FT                   VFSILPRLAPLAEVLASGETNLFNSARNIACAIKIGQGIKN"
     atgaagattg tcattgcgcc agactctttt aaagagagct taagtgcaga aaaatgttgt        60
     caggcaatta aagccgggtt ttcgaccctc tttcccgatg cgaactatat ctgtttgccg       120
     atagcggatg gcggcgaagg gacggtggat gcgatggtcg ccgcgacggg cggcaacatc       180
     gtgacgcttg aagtctgcgg gccgatgggc gaaaaagtga atgcttttta tggccttacc       240
     ggcgacggga aaacggcggt gattgagatg gcggcagcaa gtggcctgat gctggtcgcg       300
     cctgaaaagc gtaatccgtt gctggcctcc agttttggta cgggggagtt aattcgtcat       360
     gcgctggata acgacattcg ccatattatt ctcggcattg gcggcagtgc gacggtcgac       420
     ggcggtatgg gcatggcgca ggcgctcggt gtgcgtttcc ttgatgccga cggtcaggcg       480
     ctggcggcaa acggtggtaa tttagcgcgc gtggcaagca ttgagatgga tgaatgcgat       540
     ccgcgtctgg cgaattgcca tattgaagta gcatgtgacg ttgataaccc gctggtaggg       600
     gcacgcggcg cggcggcggt gtttggcccg caaaaagggg caacgccgga gatggtcgaa       660
     gaacttgaac aggggctgca aaattacgcc cgtgttttac aacagcaaac tgaaattaat       720
     gtctgccaga tggcgggcgg cggcgctgcg ggcggtatgg gtattgcggc ggcggtattt       780
     ctcaatgcgg atattaaacc gggcattgaa attgtgttga atgcggtcaa tcttgcgcag       840
     gcagtgcagg gcgcagcact ggtgattacc ggggaagggc gcatcgactc gcaaacggca       900
     ggcggtaaag cgccgctggg tgtggcgtcg gtggcgaagc agtttaatgt accggtgatt       960
     gggattgctg gcgtattggg tgatggcgtg gaagtggtgc accagtacgg cattgacgcg      1020
     gtattcagca ttttgcctcg tctggcacct ttagccgaag tgctcgccag cggtgaaacc      1080
     aatctcttca acagcgcgcg aaatattgcc tgcgccatta aaataggtca gggaattaaa      1140
     aactaa                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page