(data stored in ACNUC7421 zone)

EMBL: CP000948.HOFB

CP000948.HOFB        Location/Qualifiers
FT   CDS_pept        complement(89818..91203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofB"
FT                   /locus_tag="ECDH10B_0087"
FT                   /product="conserved protein with nucleoside triphosphate
FT                   hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01286"
FT                   /protein_id="ACB01286.1"
FT                   /translation="MNIPQLTALCLRYHGVLLDASEEVVHVAVVDAPSHELLDALHFAT
FT                   TKRIEITCWTRQQMEGHASRTQQTLPVAVQEKHQPKAELLTRTLQSALEQRASDIHIEP
FT                   ADNAYRIRLRIDGVLHPLPDVSPDAGVALTARLKVLGNLDIAEHRLPQDGQFTVELAGN
FT                   AVSFRIATLPCRGGEKVVLRLLQQVGQALDVNTLGMQPLQLADFAHALQQPQGLVLVTG
FT                   PTGSGKTVTLYSALQKLNTADINICSVEDPVEIPIAGLNQTQIHPRAGLTFQGVLRALL
FT                   RQDPDVIMIGEIRDGETAEIAIKAAQTGHLVLSTLHTNSTCETLVRLQQMGVARWMLSS
FT                   ALTLVIAQRLVRKLCPHCRRQQGEPIHIPDNVWPSPLPHWQAPGCVHCYHGFYGRTALF
FT                   EVLPITPVIRQLISANTDVESLETHARQAGMRTLFENGCLAVEQGLTTFEELIRVLGMP
FT                   HGE"
     atgaatattc cacagctcac tgccctgtgt ctgcgttatc atggagtctt gctggatgcc        60
     agcgaagagg tggttcatgt tgcggtagtc gatgcacctt cgcatgagct actggacgca       120
     ttgcatttcg ctaccaccaa acgtattgag atcacctgct ggacgcgcca acaaatggaa       180
     ggtcacgcca gtcgcacaca acagacattg cccgtagctg ttcaggagaa gcatcagccc       240
     aaagcagagt tgctaactcg aacgttacaa tctgcgctgg aacaacgcgc gtctgatatt       300
     catatcgaac cagcggacaa tgcctaccgc atccgcttgc gtatcgacgg cgtattgcat       360
     cctttaccgg atgtttcacc ggatgccgga gtcgcattaa ccgccagatt aaaagtgctg       420
     ggaaacctgg atattgcgga acatcgcctg ccgcaggacg ggcaattcac tgtcgaactg       480
     gcaggaaacg ccgtctcatt tcgtattgcg accttaccat gtcggggtgg tgaaaaggtg       540
     gtattaaggt tgttacagca ggtgggtcag gcactggatg tcaacacgct tggaatgcag       600
     ccgttacaac tggcggactt tgctcatgcc ttgcaacaac cacagggact ggtgctggta       660
     actggcccta ccggcagcgg caaaacggtc acgctttata gtgccctgca aaagctgaat       720
     accgctgaca ttaatatttg tagcgtcgaa gatccagttg agatccccat agccggacta       780
     aaccagacgc aaatccatcc gcgtgccgga ctcacctttc agggcgtttt gcgtgcgtta       840
     ttgcgccagg atcctgacgt catcatgatc ggagagatcc gcgatggcga aacagcagag       900
     atcgctatta aagcggcgca aactggtcac ctggtgttgt ctaccctaca cactaattcc       960
     acctgcgaaa cgctggtacg tttacagcaa atgggggtcg cccgctggat gctatcatcg      1020
     gcgcttacgc tggtaatagc ccagcgtctg gtacgcaaac tttgcccaca ttgtcgccgg      1080
     cagcaagggg agcccatcca cattccagac aatgtatggc catcgccgct gccccactgg      1140
     caggcacccg gttgtgtaca ttgctaccac ggtttttatg gtcgtacggc cttatttgaa      1200
     gttctgccca taacgccggt cattcgtcag cttatttccg ctaataccga cgttgaatcg      1260
     ctggaaacgc acgcacgaca ggcgggtatg cgtacgcttt ttgaaaacgg ctgcctggcc      1320
     gtagagcaag gcttaaccac ctttgaagag ttaatccgcg tactggggat gccgcatggc      1380
     gagtaa                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page