(data stored in ACNUC7421 zone)

EMBL: CP000948.HOFC

CP000948.HOFC        Location/Qualifiers
FT   CDS_pept        complement(88626..89828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofC"
FT                   /locus_tag="ECDH10B_0086"
FT                   /product="assembly protein in type IV pilin biogenesis,
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01285"
FT                   /protein_id="ACB01285.1"
FT                   /translation="MASKQLWRWHGITGDGNAQDGMLWAESRTLLLMALQQQMVTPLSL
FT                   KRIAINSAQWRGDKSAEVIHQLATLLKAGLTLSEGLALLAEQHPSKQWQALLQSLAHDL
FT                   EQGIAFSNALLPWSEVFPPLYQAMIRTGELTGKLDECCFELARQQKAQRQLTDKVKSAL
FT                   RYPIIILAMAIMVVVAMLHFVLPEFAAIYKTFNTPLPALTQGIMTLADFSGEWSWLLVL
FT                   FGFLLAIANKLLMRRPTWLIVRQKLLLRIPIMGSLMRGQKLTQIFTILALTQSAGITFL
FT                   QGVESVRETMRCPYWVQLLTQIQHDISNGQPIWLALKNTGEFSPLCLQLVRTGEASGSL
FT                   DLMLDNLAHHHRENTMALADNLAALLEPALLIITGGIIGTLVVAMYLPIFHLGDAMSGM
FT                   G"
     atggcgagta agcaactctg gcgctggcat ggcataaccg gcgacggcaa tgcgcaagat        60
     gggatgctat gggcagagag ccgtacttta ctgcttatgg cactacagca acagatggtt       120
     accccactaa gcctgaagcg aatcgccatc aattctgcgc agtggcgagg agataaaagc       180
     gcggaagtca ttcatcaact ggcgacgcta ctcaaagcag ggttaacgct ttctgaaggg       240
     ctggctctgc tggcggaaca gcatcccagt aagcaatggc aagcgttgct gcaatcgctg       300
     gcgcacgatc tcgaacaggg cattgctttt tccaatgcct tattaccctg gtcagaggta       360
     tttccgccgc tctatcaggc gatgatccgc acgggtgaac tgaccggtaa gctggatgaa       420
     tgctgctttg aactggcgcg tcagcaaaaa gcccagcgtc agttgaccga caaagtgaaa       480
     tcagcgttac gttatcccat catcatttta gcgatggcaa tcatggtggt tgtggcaatg       540
     ctgcattttg ttctgccgga gtttgccgct atctataaga ccttcaacac cccactaccg       600
     gcactaacgc aggggatcat gacgctggca gactttagtg gcgaatggag ctggctgctg       660
     gtgttgttcg gctttctgct ggcgatagcc aataagttgc tgatgcgccg accgacctgg       720
     cttatagtgc ggcagaaatt gctgttacgc atcccgatta tgggttcact gatgcgggga       780
     caaaaactca cgcagatctt tacgattctg gcgctgacac aaagtgcagg cattactttt       840
     ttacagggcg tagagagcgt cagagaaaca atgcgctgcc cgtactgggt gcaacttctg       900
     acacaaatcc agcacgatat cagtaacggt caacccatct ggctggcgct aaaaaatacc       960
     ggtgagttta gcccgctctg tttgcaatta gtgagaacag gagaggcatc cggctctctg      1020
     gatctcatgt tagacaacct cgcccatcat catcgggaaa acacaatggc gctggcggat      1080
     aacctcgcag ccttactgga accggcgttg ctgatcataa cgggaggaat tattggtacg      1140
     ctggtggtgg caatgtatct gccaattttc catttaggcg atgcgatgag tgggatggga      1200
     taa                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page