(data stored in ACNUC7421 zone)

EMBL: CP000948.HOKE

CP000948.HOKE        Location/Qualifiers
FT   CDS_pept        546391..546543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hokE"
FT                   /locus_tag="ECDH10B_0540"
FT                   /product="toxic polypeptide, small"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01703"
FT                   /protein_id="ACB01703.1"
FT                   /translation="MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA
FT                   YEPKK"
     atgctgacga aatatgccct tgcggcagtc atagtgctgt gtttaacggt gctgggattt        60
     acgcttctgg tcggagactc gctgtgtgag tttacggtga aggaacgtaa tattgagttt       120
     aaggctgttc tcgcttacga accgaagaag tag                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page