(data stored in ACNUC7421 zone)

EMBL: CP000948.HTGA

CP000948.HTGA        Location/Qualifiers
FT   CDS_pept        10830..11315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htgA"
FT                   /locus_tag="ECDH10B_0012"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01217"
FT                   /protein_id="ACB01217.1"
FT                   /translation="MRVSWLESKCDTPFANNLSFISSGSSSSSSFTLASTACRNSCLCS
FT                   SSIFFQVLRRNCSSNCCSISNVDISLSAFSFNRFETSSKMARYNLPCPRSLLAILSPPK
FT                   CCNSPAISCQLRRCCSGCPSIDLNSSLRISTLERRVLPFSLWVSNRAKFANCSSLQC"
     atgcgggtca gttggctgga aagcaaatgc gacacacctt ttgccaataa tttgtctttc        60
     atcagcagcg gcagcagctc ttccagctca ttcaccctgg catcgaccgc gtgcagaaac       120
     tcctgcttat gttcctcgtc cattttcttc caggtattac gcagaaattg ttccagtaac       180
     tgttgctcaa tttcaaacgt agacatctct ttgtcggctt tcagcttcaa tcgctttgaa       240
     acatcgagca aaatggcccg atacaattta ccgtgtccgc gcagtttgtt ggcgatacta       300
     tcgccaccaa aatgctgtaa ttctccggca atcagctgcc agttgcggcg atgttgctcg       360
     ggatgccctt ccatcgattt aaacagttcg ttgcgcatca gtacgctgga gaggcgagtt       420
     ttgccttttt cattatgggt gagcaatcgg gcgaaatttg ccaactgttc ctcactacaa       480
     tgctga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page