(data stored in ACNUC7421 zone)

EMBL: CP000948.HTRE

CP000948.HTRE        Location/Qualifiers
FT   CDS_pept        complement(126933..129530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrE"
FT                   /locus_tag="ECDH10B_0119"
FT                   /product="predicted outer membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01318"
FT                   /protein_id="ACB01318.1"
FT                   /translation="MTIEYTKNYHHLTRIATFCALLYCNTAFSAELVEYDHTFLMGQNA
FT                   SNIDLSRYSEGNPAIPGVYDVSVYVNDQPIINQSITFVAIEGKKNAQACITLKNLLQFH
FT                   INSPDINNEKAVLLARDETLGNCLNLTEIIPQASVRYDVNDQRLDIDVPQAWVMKNYQN
FT                   YVDPSLWENGINAAMLSYNLNGYHSETPGRKNESIYAAFNGGMNLGAWRLRASGNYNWM
FT                   TDSGSNYDFKNRYVQRDIASLRSQLILGESYTTGETFDSVSIRGIRLYSDSRMLPPTLA
FT                   SFAPIIHGVANTNAKVTITQGGYKIYETTVPPGAFVIDDLSPSGYGSDLIVTIEESDGS
FT                   KRTFSQPFSSVVQMLRPGVGRWDISGGQVLKDDIQDEPNLFQASYYYGLNNYLTGYTGI
FT                   QITDNNYTAGLLGLGLNTSVGAFSFDVTHSNVRIPDDKTYQGQSYRVSWNKLFEETSTS
FT                   LNIAAYRYSTQNYLGLNDALTLIDEVKHPEQDLEPKSMRNYSRMKNQVTVSINQPLKFE
FT                   KKDYGSFYLSGSWSDYWASGQNRSNYSIGYSNSTSWGSYSVSAQRSWNEDGDTDDSVYL
FT                   SFTIPIEKLLGTEQRTSGFQSIDTQISSDFKGNNQLNVSSSGYSDNARVSYSVNTGYTM
FT                   NKASKDLSYVGGYASYESPWGTLAGSISANSDNSRQVSLSTDGGFVLHSGGLTFSNDSF
FT                   SDSDTLAVVQAPGAQGARINYGNSTIDRWGYGVTSALSPYHENRIALDINDLENDVELK
FT                   STSAVAVPRQGSVVFADFETVQGQSAIMNITRSDGKNIPFAADIYDEQGNVIGNVGQGG
FT                   QAFVRGIEQQGNISIKWLEQSKPVSCLAHYQQSPEAEKIAQSIILNGIRCQIQ"
     gtgactatag aatatactaa aaattatcat catctgaccc gtatcgccac gttttgcgcg        60
     ctgctgtatt gcaatactgc tttcagtgct gaactcgttg aatatgacca taccttcctg       120
     atggggcaga atgcatctaa tattgatctc agccggtaca gtgaaggtaa ccccgctata       180
     ccgggtgttt acgacgtcag tgtttatgta aacgaccaac caatcattaa ccaaagtatt       240
     acatttgtcg caattgaagg aaaaaagaac gcccaggctt gtatcacatt aaagaattta       300
     ttgcagtttc atattaattc tcccgatata aataacgaaa aagccgttct gcttgccagg       360
     gatgaaacgc tcggcaattg cctcaatttg acggaaatta tccctcaggc ttctgttcgt       420
     tatgacgtta acgatcaacg tctggatata gacgttcctc aagcctgggt aatgaaaaat       480
     taccaaaact atgttgatcc atcgttatgg gaaaacggca ttaatgcggc catgttgtca       540
     tacaacctca acggatatca tagtgaaacc cctggtcgaa aaaatgaaag catttatgct       600
     gcatttaacg gtgggatgaa tttaggtgca tggcgactgc gtgcctcggg caactacaac       660
     tggatgaccg attctggcag taattatgat tttaagaatc ggtatgttca gcgtgatatc       720
     gcctcgctgc gttctcaact cattcttggt gagtcttata cgacgggcga aacctttgat       780
     tccgtcagta tccgaggcat tcgtttatac agtgacagcc gcatgttgcc tccgacttta       840
     gccagctttg cgcctatcat tcatggcgtt gccaatacca acgccaaagt cactattacg       900
     caaggtggct ataagattta tgaaacgacg gtgccgccag gcgctttcgt cattgatgat       960
     ctgagtccgt cagggtacgg cagcgatctt attgttacca tcgaagaatc cgatggctca      1020
     aagcggacat tctcgcaacc tttctcatcc gttgttcaaa tgttacgccc tggcgttgga      1080
     cgttgggata ttagcggcgg tcaggtctta aaagatgata ttcaggatga gcctaattta      1140
     tttcaagcaa gctactacta cggcctgaat aactatctga cgggttatac cggtattcag      1200
     ataaccgata ataactatac cgctggtttg ttaggtcttg gtctgaatac ttcagttggt      1260
     gcattttctt tcgatgtgac tcattccaat gttcgtatcc cggatgataa aacataccag      1320
     gggcaaagtt atcgtgtttc ctggaacaag ttattcgaag aaacaagtac ttcactgaat      1380
     atcgcggcct atcgctattc gacacagaat taccttggtc ttaatgatgc actaactcta      1440
     attgatgaag tgaaacatcc cgaacaagat cttgaaccga aatccatgcg taattactca      1500
     cgcatgaaaa atcaggttac ggtcagtatt aaccaaccgt tgaaatttga gaaaaaagat      1560
     tacggttcat tttatctttc cggaagttgg tccgattact gggcttccgg acaaaatcgt      1620
     agcaattact ctattggcta cagtaacagt acatcctggg gcagctacag tgtcagtgcc      1680
     cagcgttcat ggaatgaaga cggcgacact gacgatagcg tttatcttag tttcaccatt      1740
     ccaattgaaa aattacttgg cactgaacaa cgtacttcag gtttccagag tattgatact      1800
     caaataagca gtgactttaa gggtaataac caactcaacg ttagcagcag tggctatagc      1860
     gataacgctc gcgtcagtta tagcgtgaat actggctata cgatgaataa agccagcaaa      1920
     gatttgagtt atgttggggg ttatgccagc tatgagtcac catggggaac gctggcaggt      1980
     tcaatttctg caaatagcga taacagccgt caagtttctc tcagcaccga cggtggtttt      2040
     gtattgcata gcggtggact gactttcagt aatgatagtt ttagcgactc cgatacactg      2100
     gcggtagttc aggctccagg tgctcaagga gcgcgaataa attatggcaa cagtactatc      2160
     gatcgatggg gttatggtgt caccagcgct ctttctcctt atcatgaaaa ccgtatcgcg      2220
     ctggatatca acgatcttga gaacgatgtt gaattaaaaa gtaccagtgc agtagctgta      2280
     ccgcgtcagg gttcagtcgt ctttgctgat tttgaaaccg tgcaagggca atcagccatt      2340
     atgaacatca cacgaagtga tggtaaaaat attccatttg ctgcagatat ttatgatgag      2400
     caaggcaatg tcattggtaa tgttggacag ggtggacaag catttgttcg tggtattgag      2460
     cagcagggaa atatcagcat taaatggctc gaacaaagta aacccgtaag ttgtcttgcg      2520
     cattatcaac aaagcccaga agcagaaaaa atagcacaat ctattattct gaatggaatt      2580
     cggtgtcaga ttcagtaa                                                    2598
//

If you have problems or comments...

PBIL Back to PBIL home page