(data stored in ACNUC7421 zone)

EMBL: CP000948.IMP

CP000948.IMP         Location/Qualifiers
FT   CDS_pept        complement(54755..57109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="ECDH10B_0055"
FT                   /product="exported protein required for envelope
FT                   biosynthesis and integrity"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01259"
FT                   /protein_id="ACB01259.1"
FT                   /translation="MKKRIPTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQG
FT                   DTNDLPVTINADHAKGDYPDDAVFTGSVDIMQGNSRLQADEVQLHQKEAPGQPEPVRTV
FT                   DALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYT
FT                   ILDNGSFTSCLPGSDTWSVVGSEIIHDREEQVAEIWNARFKVGPVPIFYSPYLQLPVGD
FT                   KRRSGFLIPNAKYTTTNYFEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEFRYLSQ
FT                   AGAGLMELDYLPSDKVYEDEHPNDDSSRRWLFYWNHSGVMDQVWRFNVDYTKVSDPSYF
FT                   NDFDNKYGSSTDGYATQKFSVGYAVQNFNATVSTKQFQVFSEQNTSSYSAEPQLDVNYY
FT                   QNDVGPFDTRIYGQAVHFVNTRDDMPEATRVHLEPTINLPLSNNWGSINTEAKLLATHY
FT                   QQTNLDWYNSRNTTKLDESVNRVMPQFKVDGKMVFERDMEMLAPGYTQTLEPRAQYLYV
FT                   PYRDQSDIYNYDSSLLQSDYSGLFRDRTYGGLDRIASANQVTTGVTSRIYDDAAVERFN
FT                   ISVGQIYYFTESRTGDDNITWENDDKTGSLVWAGDTYWRISERWGLRGGIQYDTRLDNV
FT                   ATSNSSIEYRRDEDRLVQLNYRYASPEYIQATLPKYYSTAEQYKNGISQVGAVASWPIA
FT                   DRWSIVGAYYYDTNANKQADSMLGVQYSSCCYAIRVGYERKLNGWDNDKQHAVYDNAIG
FT                   FNIELRGLSSNYGLGTQEMLRSNILPYQNTL"
     atgaaaaaac gtatccccac tctcctggcc accatgattg ccaccgccct ttatagtcaa        60
     cagggactgg cagccgacct cgcctcacag tgcatgttgg gcgtgccaag ctatgaccgt       120
     cctctggtac agggcgatac caatgactta cccgtgacta tcaatgctga ccacgcgaaa       180
     ggggactacc cggatgacgc cgtgtttact ggcagcgtgg atatcatgca gggtaacagc       240
     cgtctgcagg ccgacgaagt gcagctccat caaaaagagg caccaggaca accggagccg       300
     gtacgtaccg ttgatgcgct cggtaatgtc cattacgacg ataaccaggt gatcctcaaa       360
     gggccgaaag gctgggcgaa tctgaacacc aaagatacca acgtctggga aggtgattac       420
     cagatggtgg gtcgccaggg tcgcggtaaa gcggacctga tgaaacaacg tggcgaaaac       480
     cgctatacca ttctggataa cggtagcttt acctcctgtc tgccgggttc tgacacctgg       540
     agcgtggtag gtagcgaaat tattcatgac cgcgaagaac aagttgcgga gatctggaac       600
     gcccgcttta aggtgggtcc ggtaccgatc ttttatagcc cctatttgca gttgccggtg       660
     ggtgacaaac gtcgctctgg tttcttgatc ccgaacgcca agtacaccac caccaactac       720
     tttgagttct acctgccata ttactggaac atcgcgccaa atatggatgc caccatcacg       780
     ccgcattata tgcatcgtcg tggcaacatc atgtgggaga acgaattccg ctacctctcc       840
     caggcgggcg ctggcttgat ggaactggac tatctgcctt cagataaagt ctatgaagat       900
     gaacacccga acgatgacag ttcacgtcgt tggttattct actggaacca ctccggggtc       960
     atggatcagg tgtggcgttt caacgtcgac tacaccaagg tcagcgatcc tagctacttc      1020
     aatgatttcg ataacaagta cggttccagt actgacggct acgcaacgca aaaattcagc      1080
     gttggctatg cggtgcaaaa cttcaatgcc accgtttcaa ccaagcagtt ccaggttttc      1140
     agcgaacaga acaccagtag ctactcggca gagccgcagt tagacgttaa ttactaccag      1200
     aatgatgttg gtccgtttga tacgcgtatt tacggccagg cagtgcactt tgttaacacc      1260
     agagacgaca tgcctgaagc aacccgtgtt cacctggaac cgaccatcaa tttgccgctc      1320
     tctaataact ggggcagcat caataccgaa gcgaagttgc tggcaaccca ttatcagcaa      1380
     accaatcttg actggtataa ctccagaaac acgaccaagc tggacgaatc cgttaaccgc      1440
     gtaatgccgc aattcaaagt tgacggcaaa atggtctttg aacgcgatat ggaaatgctg      1500
     gctccgggtt atacccaaac gctggaaccg cgcgcgcagt atttgtacgt gccgtatcgc      1560
     gatcagagcg acatctataa ctacgactcg tctctgctgc aatctgacta ctctggcctg      1620
     ttccgggacc ggacttacgg cggtcttgac cgtattgcct ccgctaacca ggtgacgacc      1680
     ggtgtcacat ctcgcatata tgatgatgct gccgttgaac gttttaatat ttccgttggt      1740
     caaatctact atttcacgga gtctcgcact ggcgatgaca acataacatg ggagaatgac      1800
     gacaaaacgg gttcactggt gtgggcaggc gatacttact ggcgtatctc cgagcgttgg      1860
     ggattgcgtg gcgggattca gtacgataca cgtctggata acgtagcgac cagtaactcc      1920
     agcattgaat accgtcggga tgaagaccgt ctggtacagc tgaattaccg ttacgccagc      1980
     ccggaatata ttcaggctac gctgcctaag tactattcca ctgctgagca atataagaat      2040
     ggtatttcgc aggtaggtgc tgtcgccagc tggccaattg ccgatcgttg gtccattgtt      2100
     ggggcctact actacgacac caatgctaac aagcaagccg actctatgtt aggtgtgcaa      2160
     tacagctcct gctgctatgc aattcgcgtc ggttacgagc ggaagctgaa cggttgggat      2220
     aacgataaac aacatgcggt atatgacaac gcaatcggct ttaacatcga acttcgcggc      2280
     ctgagctcca actacggtct gggtacgcaa gagatgctgc gttcgaacat tctgccgtat      2340
     caaaacactt tgtga                                                       2355
//

If you have problems or comments...

PBIL Back to PBIL home page