(data stored in ACNUC7421 zone)

EMBL: CP000948.INSA-2

CP000948.INSA-2      Location/Qualifiers
FT   CDS_pept        complement(252928..253203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insA-2"
FT                   /locus_tag="ECDH10B_0251"
FT                   /product="CP4-6 prophage; IS1 repressor protein InsA"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01431"
FT                   /protein_id="ACB01431.1"
FT                   /translation="MASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLQFTY
FT                   TASQPGTHQKIIDMAMNGVGCRATARIMGVGLNTIFRHLKNSGRSR"
     gtggcttctg tttctatcag ctgtccctcc tgttcagcta ctgacggggt ggtgcgtaac        60
     ggcaaaagca ctgccggaca tcagcgctat ctctgctctc actgccgtaa aacatggcaa       120
     ctgcagttca cttacaccgc ttctcaaccc ggtacgcacc agaaaatcat tgatatggcc       180
     atgaatggcg ttggatgccg ggcaaccgcc cgcattatgg gcgttggcct caacacgatt       240
     ttccgccatt taaaaaactc aggccgcagt cggtaa                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page