(data stored in ACNUC7421 zone)

EMBL: CP000948.INSE-1

CP000948.INSE-1      Location/Qualifiers
FT   CDS_pept        290056..290364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insE-1"
FT                   /locus_tag="ECDH10B_0287"
FT                   /product="IS3 element protein InsE"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01465"
FT                   /protein_id="ACB01465.1"
FT                   /translation="MTHMTKTVSTSKKPRKQHSPEFRSEALKLAERIGVTAAARELSLY
FT                   ESQLYNWRSKQQNQQTSSERELEMSTEIARLKRQLAERDEELAILQKAATYFAKRLK"
     gtgactcaca tgacaaaaac agtatcaacc agtaaaaaac cccgtaaaca gcattcgcct        60
     gaatttcgca gtgaagccct gaagcttgct gaacgcatcg gtgttactgc cgcagcccgt       120
     gaactcagcc tgtatgaatc acaactctac aactggcgca gtaaacagca aaatcagcag       180
     acgtcttctg aacgtgaact ggagatgtct accgagattg cacgtctcaa acgccagctg       240
     gcagaacggg atgaagagct ggctatcctc caaaaggccg cgacatactt cgcgaagcgc       300
     ctgaaatga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page