(data stored in ACNUC7421 zone)

EMBL: CP000948.INSF-1

CP000948.INSF-1      Location/Qualifiers
FT   CDS_pept        290361..291227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insF-1"
FT                   /locus_tag="ECDH10B_0288"
FT                   /product="IS3 element protein InsF"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01466"
FT                   /protein_id="ACB01466.1"
FT                   /translation="MKYVFIEKHQAEFSIKAMCRVLRVARSGWYTWCQRRTRISTRQQF
FT                   RQHCDSVVLAAFTRSKQRYGAPRLTDELRAQGYPFNVKTVAASLRRQGLRAKASRKFSP
FT                   VSYRAHGLPVSENLLEQDFYASGPNQKWAGDITYLRTDEGWLYLAVVIDLWSRAVIGWS
FT                   MSPRMTAQLACDALQMALWRRKRPRNVIVHTDRGGQYCSADYQAQLKRHNLRGSMSAKG
FT                   CCYDNACVESFFHSLKVECIHGEHFISREIMRATVFNYIECDYNRWRRHSWCGGLSPEQ
FT                   FENKNLA"
     atgaagtatg tctttattga aaaacatcag gctgagttca gcatcaaagc aatgtgccgc        60
     gtgctccggg tggcccgcag cggctggtat acgtggtgtc agcggcggac aaggataagc       120
     acgcgtcagc agttccgcca acactgcgac agcgttgtcc tcgcggcttt tacccggtca       180
     aaacagcgtt acggtgcccc acgcctgacg gatgaactgc gtgctcaggg ttaccccttt       240
     aacgtaaaaa ccgtggcggc aagcctgcgc cgtcagggac tgagggcaaa ggcctcccgg       300
     aagttcagcc cggtcagcta ccgcgcacac ggcctgcctg tgtcagaaaa tctgttggag       360
     caggattttt acgccagtgg cccgaaccag aagtgggcag gagacatcac gtacttacgt       420
     acagatgaag gctggctgta tctggcagtg gtcattgacc tgtggtcacg tgccgttatt       480
     ggctggtcaa tgtcgccacg catgacggcg caactggcct gcgatgccct gcagatggcg       540
     ctgtggcggc gtaagaggcc ccggaacgtt atcgttcaca cggaccgtgg aggccagtac       600
     tgttcagcag attatcaggc gcaactgaag cggcataatc tgcgtggaag tatgagcgca       660
     aaaggttgct gctacgataa tgcctgcgtg gaaagcttct ttcattcgct gaaagtggaa       720
     tgtatccatg gagaacactt tatcagccgg gaaataatgc gggcaacggt gtttaattat       780
     atcgaatgtg attacaatcg gtggcggcgg cacagttggt gtggcggcct cagtccggaa       840
     caatttgaaa acaagaacct cgcttag                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page