(data stored in ACNUC7421 zone)

EMBL: CP000948.IRAP

CP000948.IRAP        Location/Qualifiers
FT   CDS_pept        339941..340201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iraP"
FT                   /gene_synonym="yaiB"
FT                   /locus_tag="ECDH10B_0339"
FT                   /product="anti-adaptor protein"
FT                   /function="interacts with RssB, inhibiting ClpXP-mediated
FT                   degradation of RpoS during stationary phase and periods of
FT                   phosphate and nitrogen starvation"
FT                   /note="GO_process: GO:0016036 - cellular response to
FT                   phosphate starvation"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01511"
FT                   /db_xref="GOA:B1XEX1"
FT                   /db_xref="InterPro:IPR019732"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XEX1"
FT                   /protein_id="ACB01511.1"
FT                   /translation="MKNLIAELLFKLAQKEEESKELCAQVEALEIIVTAMLRNMAQNDQ
FT                   QRLIDQVEGALYEVKPDASIPDDDTELLRDYVKKLLKHPRQ"
     atgaaaaatc tcattgctga gttgttattt aagcttgccc aaaaagaaga agagtcgaaa        60
     gaactgtgtg cgcaggtaga agctttggag attatcgtca ctgcaatgct tcgcaatatg       120
     gcgcaaaatg accaacagcg gttgattgat caggtagagg gggcgctgta cgaggtaaag       180
     cccgatgcca gcattcctga cgacgatacg gagctgctgc gcgattacgt aaagaagtta       240
     ttgaagcatc ctcgtcagta a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page