(data stored in ACNUC7421 zone)

EMBL: CP000948.KDPB

CP000948.KDPB        Location/Qualifiers
FT   CDS_pept        complement(776803..778851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /locus_tag="ECDH10B_0763"
FT                   /product="potassium translocating ATPase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01906"
FT                   /db_xref="GOA:B1X6M8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1X6M8"
FT                   /protein_id="ACB01906.1"
FT                   /translation="MSRKQLALFEPTLVVQALKEAVKKLNPQAQWRNPVMFIVWIGSLL
FT                   TTCISIAMASGAMPGNALFSAAISGWLWITVLFANFAEALAEGRSKAQANSLKGVKKTA
FT                   FARKLREPKYGAAADKVPADQLRKGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESA
FT                   PVIRESGGDFASVTGGTRILSDWLVIECSVNPGETFLDRMIAMVEGAQRRKTPNEIALT
FT                   ILLIALTIVFLLATATLWPFSAWGGNAVSVTVLVALLVCLIPTTIGGLLSAIGVAGMSR
FT                   MLGANVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVDEKTLADAAQLA
FT                   SLADETPEGRSIVILAKQRFNLRERDVQSLHATFVPFTAQSRMSGINIDNRMIRKGSVD
FT                   AIRRHVEANGGHFPTDVDQKVDQVARQGATPLVVVEGSRVLGVIALKDIVKGGIKERFA
FT                   QLRKMGIKTVMITGDNRLTAAAIAAEAGVDDFLAEATPEAKLALIRQYQAEGRLVAMTG
FT                   DGTNDAPALAQADVAVAMNSGTQAAKEAGNMVDLDSNPTKLIEVVHIGKQMLMTRGSLT
FT                   TFSIANDVAKYFAIIPAAFAATYPQLNALNIMCLHSPDSAILSAVIFNALIIVFLIPLA
FT                   LKGVSYKPLTASAMLRRNLWIYGLGGLLVPFIGIKVIDLLLTVCGLV"
     atgagtcgta aacaactggc gctattcgaa ccaacacttg tcgttcaggc gctgaaagaa        60
     gcggtgaaaa aattaaaccc gcaggcgcaa tggcgcaatc cggtgatgtt tatcgtctgg       120
     atcggcagtc tgctgaccac ctgtattagc atcgcgatgg caagcggtgc gatgcccggc       180
     aatgcgctgt ttagcgcggc cattagcggt tggctgtgga tcaccgtact gttcgctaat       240
     ttcgccgagg cgctggcaga aggccgcagt aaagcgcagg ccaacagtct gaaaggggtg       300
     aaaaaaactg cctttgcccg caagctgcgt gagccgaaat atggcgctgc ggcggacaaa       360
     gttcctgccg accaacttcg taaaggcgat atcgtactgg tagaagctgg cgatattatc       420
     ccctgcgatg gtgaagttat tgaagggggt gcatcggtcg atgaaagcgc catcaccggg       480
     gaatcggcac cggtgatccg tgaatccggc ggcgattttg cctccgtcac cggcggcacg       540
     cgtattcttt ctgactggct ggtgattgag tgtagcgtta accccggcga gacatttctg       600
     gatcggatga tcgcgatggt ggaaggcgca cagcgacgca aaacgccgaa cgaaattgcc       660
     ctgaccattc tgctgattgc cctgactatc gtctttttac tggcaaccgc cacgctgtgg       720
     ccgttttccg cgtggggcgg taatgcagtc agcgtaacgg tactggtggc gctgctggtc       780
     tgtctgatcc caaccactat tggcggcctg ttgtcagcga tcggcgtcgc cgggatgagc       840
     cggatgctag gcgcgaatgt gattgccacc agcggacgtg cagttgaagc ggcaggtgac       900
     gttgacgttc tgctactgga taaaaccggc accatcacac tcggtaaccg tcaggcgtcg       960
     gagtttatcc ccgcgcaggg cgtggatgaa aaaacgctgg ctgacgccgc acaactggct      1020
     tcgctggctg atgaaacgcc ggaaggccgc agtattgtga tcctcgccaa gcagcgtttt      1080
     aacctgcgcg agcgcgatgt gcagtcgctc catgccacct ttgtaccgtt tactgcgcaa      1140
     agccggatga gcgggatcaa catcgacaac cgcatgatcc gtaaaggttc tgtcgatgcc      1200
     attcgtcgcc atgttgaggc taacggtggt cacttcccta ccgatgttga tcaaaaagtc      1260
     gatcaggttg cgcgtcaggg agccacgccg ctggtggtgg tggaaggttc tcgtgtgctg      1320
     ggcgttattg cgctgaaaga tatcgtcaaa ggcggtatta aagagcgctt cgcccagctg      1380
     cgcaaaatgg gcattaaaac ggtgatgatt accggcgata accgtctgac tgccgccgcg      1440
     attgctgcgg aagcgggtgt cgatgatttt ctcgccgaag cgacaccgga ggccaagctg      1500
     gcattgatcc gtcagtatca ggcggaaggt cgtttggtag cgatgaccgg cgacggcacc      1560
     aacgatgctc cggcgctggc gcaggcagat gtcgcggtgg cgatgaactc cggcacccag      1620
     gcggcgaaag aggcgggcaa tatggtcgat ctcgactcta acccgaccaa gttgatcgag      1680
     gtggtgcaca ttggcaaaca gatgctgatg acccgtggct cgctgaccac cttcagcatt      1740
     gccaacgatg tggcgaaata cttcgccatt attccggcgg cattcgcggc aacgtatccg      1800
     cagttaaatg cgctgaacat catgtgcctg cattcgcccg actccgcaat cctcagtgcg      1860
     gtgattttca acgccttgat tatcgtcttt ttgattcccc tggcgttaaa aggcgtgagt      1920
     tataaaccgc ttaccgcttc tgccatgttg cgccgtaact tatggattta cggtctgggt      1980
     gggctgctgg tgccgtttat cggtatcaaa gtcattgatt tactgctgac cgtttgcggt      2040
     ctggtgtga                                                              2049
//

If you have problems or comments...

PBIL Back to PBIL home page