(data stored in ACNUC7421 zone)

EMBL: CP000948.KDPC

CP000948.KDPC        Location/Qualifiers
FT   CDS_pept        complement(776222..776794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="ECDH10B_0762"
FT                   /product="potassium translocating ATPase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01905"
FT                   /db_xref="GOA:B1X6M7"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1X6M7"
FT                   /protein_id="ACB01905.1"
FT                   /translation="MSGLRPALSTFIFLLLITGGVYPLLTTVLGQWWFPWQANGSLIRE
FT                   GDTVRGSALIGQNFTGNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKLIAARVAA
FT                   LRAANPDASASVPVELVTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYS
FT                   QQPLVKYIGQPVVNIVELNLALDKLDE"
     atgagtggat tacgtccggc attatcaaca tttatctttc tgttattgat tactggcggc        60
     gtttacccgc tgctgaccac cgtactgggg caatggtggt ttccctggca ggccaatggt       120
     tcgttgattc gtgaaggtga tacggtgcgc ggttcggcat taatcgggca gaattttacc       180
     ggcaacggct attttcatgg tcgcccgtcg gcaacggcag aaatgcccta taatccacag       240
     gcttctggcg ggagcaatct ggcggtcagt aaccctgagc tggataaact aatagccgca       300
     cgcgttgctg cattacgggc cgctaacccg gatgccagcg cgagcgttcc ggttgaactg       360
     gtgacggcat cggcaagcgg gctggacaat aatatcaccc cgcaagcggc ggcctggcaa       420
     atcccacgcg tggcgaaagc gcgtaatctc agcgttgaac agctcacgca actgatcgca       480
     aaatacagcc aacaaccgct ggtgaaatat atcggccagc cggttgtcaa cattgttgaa       540
     ctcaatctgg cgctggataa acttgatgaa taa                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page