(data stored in ACNUC7421 zone)

EMBL: CP000948.KDPD

CP000948.KDPD        Location/Qualifiers
FT   CDS_pept        complement(773545..776229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpD"
FT                   /locus_tag="ECDH10B_0761"
FT                   /product="fused sensory histidine kinase in two-component
FT                   regulatory system with KdpE: signal sensing protein and
FT                   sensory histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01904"
FT                   /protein_id="ACB01904.1"
FT                   /translation="MNNEPLRPDPDRLLEQTAAPHRGKLKVFFGACAGVGKTWAMLAEA
FT                   QRLRAQGLDIVVGVVETHGRKDTAAMLEGLAVLPLKRQAYRGRHISEFDLDAALARRPA
FT                   LILMDELAHSNAPGSRHPKRWQDIEELLEAGIDVFTTVNVQHLESLNDVVSGVTGIQVR
FT                   ETVPDPFFDAADDVVLVDLPPDDLRQRLKEGKVYIAGQAERAIEHFFRKGNLIALRELA
FT                   LRRTADRVDEQMRAWRGHPGEEKVWHTRDAILLCIGHNTGSEKLVRAAARLASRLGSVW
FT                   HAVYVETPALHRLPEKKRRAILSALRLAQELGAETATLSDPAEEKAVVRYAREHNLGKI
FT                   ILGRPASRRWWRRETFADRLARIAPDLDQVLVALDEPPARTINNAPDNRSFKDKWRVQI
FT                   QGCVVAAALCAVITLIAMQWLMAFDAANLVMLYLLGVVVVALFYGRWPSVVATVINVVS
FT                   FDLFFIAPRGTLAVSDVQYLLTFAVMLTVGLVIGNLTAGVRYQARVARYREQRTRHLYE
FT                   MSKALAVGRSPQDIAATSEQFIASTFHARSQVLLPDDNGKLQPLTHPQGMTPWDDAIAQ
FT                   WSFDKGLPAGAGTDTLPGVPYQILPLKSGEKTYGLVVVEPGNLRQLMIPEQQRLLETFT
FT                   LLVANALERLTLTASEEQARMASEREQIRNALLAALSHDLRTPLTVLFGQAEILTLDLA
FT                   SEGSPHARQASEIRQHVLNTTRLVNNLLDMARIQSGGFNLKKEWLTLEEVVGSALQMLE
FT                   PGLSSPINLSLPEPLTLIHVDGPLFERVLINLLENAVKYAGAQAEIGIDAHVEGENLQL
FT                   DVWDNGPGLPPGQEQTIFDKFARGNKESAVPGVGLGLAICRAIVDVHGGTITAFNRPEG
FT                   GACFRVTLPQQTAPELEEFHEDM"
     atgaataacg aacccttacg tcccgacccc gatcgtctgc tggaacaaac tgccgcgccg        60
     catcggggga agctgaaagt tttcttcggt gcctgtgcag gcgtcgggaa gacctgggcg       120
     atgctggcag aagcccagcg actgcgggcg caagggctgg atattgtggt tggcgtggta       180
     gaaacccacg ggcgaaaaga taccgccgcc atgctggaag ggctggctgt tctgccgtta       240
     aaacgccagg cgtaccgtgg gcggcatatc agcgagtttg atctcgatgc cgccctcgcc       300
     cgccgcccgg cgctgatctt aatggacgaa ctggcgcaca gtaatgcgcc aggttcccgt       360
     catcccaaac gctggcagga tatcgaagaa ctgctggaag ctggcattga tgttttcact       420
     accgtcaacg ttcagcatct ggaaagtctg aatgatgtgg tcagcggcgt caccggaatt       480
     caggtacggg aaaccgtgcc cgatcctttt ttcgatgccg ccgacgacgt ggtgctggtg       540
     gacttgcccc cggacgatct gcgccagcgg ctgaaagaag gcaaagtcta tattgccggg       600
     caggcggagc gcgccattga acattttttc cgcaaaggta atctgatcgc cctgcgcgaa       660
     ctggcactgc gccgtactgc cgatcgcgtt gatgagcaaa tgcgcgcctg gcgggggcat       720
     cctggcgaag agaaagtgtg gcacacgcgc gacgcgatcc ttttatgcat cggccataac       780
     accggcagcg aaaaactggt ccgcgcagcg gcgcggctgg cgtcacggct gggtagcgtc       840
     tggcacgcgg tgtatgttga aacccctgcc ctgcaccgct taccggaaaa aaaacgtcgg       900
     gcaattctca gcgccttacg tctggcgcag gaactgggcg cggagacggc aacactttct       960
     gatccagcgg aagagaaagc ggtagtgcgt tatgcccgtg aacataatct cggcaagatt      1020
     attctcggtc gcccggcctc gcgccgctgg tggcgtcggg aaacgtttgc tgaccgactg      1080
     gcgcgcatcg cccccgatct cgatcaggtg ctggtcgcgc ttgatgaacc acccgcccgc      1140
     acgattaaca acgcgccgga taaccgctct tttaaagaca agtggcgtgt acaaattcag      1200
     ggatgcgtgg ttgccgccgc gttatgcgcc gttatcacct taattgccat gcagtggctg      1260
     atggcgtttg atgccgccaa cctggtgatg ctgtatctgc ttggcgtggt ggtggtggcg      1320
     ctattttatg gacgctggcc ttcagtggtt gccaccgtca ttaatgtagt gagtttcgat      1380
     ctctttttta tcgccccacg cggcacgctc gccgtctctg atgtgcaata tctgctgacc      1440
     ttcgcggtga tgttaaccgt cgggctggtg atcgggaacc ttactgctgg cgtgcgttat      1500
     caggcgcggg tagcccgtta ccgcgagcaa cgcacacggc acttatatga aatgtcgaaa      1560
     gctctggcgg tgggccgcag tccgcaggat atcgctgcca ccagcgaaca atttattgcc      1620
     tccacgtttc atgcccgcag tcaggtgttg ttgcccgatg acaacggtaa attgcagccg      1680
     ttaacacatc cgcaaggaat gacgccgtgg gacgatgcca tcgcgcagtg gagttttgat      1740
     aaaggcctgc ctgcgggcgc gggcaccgac acgttacccg gtgtaccgta ccagattttg      1800
     ccgctaaaaa gcggcgagaa aacctacggg ctggtggtgg tggagccggg gaatctgcgc      1860
     cagttgatga tcccggaaca gcagcgcctg ctggagacgt ttacgctgtt agtcgccaat      1920
     gcccttgagc ggctgacgct aaccgccagc gaagaacagg cgcggatggc aagcgaacgt      1980
     gaacagatcc gcaacgccct gctggcggcg ctttcgcatg atttacgcac gccgcttacg      2040
     gtgctgtttg gtcaggcaga aatcttaacg ctcgatctgg caagcgaagg atcaccccac      2100
     gcccgccagg ccagcgagat ccgtcagcat gtgctgaaca ctacccgact ggtgaataat      2160
     ctactggata tggcgcgaat tcagtccggc ggctttaatt tgaagaaaga gtggttaacg      2220
     ctggaagaag tagtcggcag cgcgctgcaa atgctggaac cgggtttatc gtcgcccatc      2280
     aatctttctc tgccagaacc gctgacctta atccacgttg acgggccact ctttgaacgg      2340
     gtgctgatta atctgctgga gaacgcggtg aaatatgcgg gtgcgcaggc cgaaattggt      2400
     atcgatgccc acgttgaggg cgaaaatcta caactggatg tctgggataa cggccccggt      2460
     cttccgccag gccaggagca gacgatattt gataagtttg ctcgcgggaa taaagagtcg      2520
     gcagtaccgg gggtagggct tggactggca atttgtcggg cgatagtgga tgtacacggg      2580
     ggcactatta ccgcgttcaa ccgaccggaa ggtggtgcct gttttcgtgt tacacttccc      2640
     cagcaaactg cccctgaact tgaagaattt catgaggata tgtga                      2685
//

If you have problems or comments...

PBIL Back to PBIL home page