(data stored in ACNUC7421 zone)

EMBL: CP000948.KEFF

CP000948.KEFF        Location/Qualifiers
FT   CDS_pept        47246..47776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefF"
FT                   /locus_tag="ECDH10B_0047"
FT                   /product="flavoprotein subunit for the KefC potassium
FT                   efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01251"
FT                   /db_xref="GOA:B1XC47"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023948"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XC47"
FT                   /protein_id="ACB01251.1"
FT                   /translation="MILIIYAHPYPHHSHANKRMLEQARTLEGVEIRSLYQLYPDFNID
FT                   IAAEQEALSRADLIVWQHPMQWYSIPPLLKLWIDKVFSHGWAYGHGGTALHGKHLLWAV
FT                   TTGGGESHFEIGAHPGFDVLSQPLQATAIYCGLNWLPPFAMHCTFICDDETLEGQARHY
FT                   KQRLLEWQEAHHG"
     atgattctta taatttatgc gcatccgtat ccgcatcatt cccatgcgaa taaacggatg        60
     cttgaacagg caaggacgct ggaaggcgtc gaaattcgct ctctttatca actctatcct       120
     gacttcaata tcgatattgc cgccgagcag gaggcgctgt ctcgcgccga tctgatcgtc       180
     tggcagcatc cgatgcagtg gtacagcatt cctccgctcc tcaaactttg gatcgataaa       240
     gttttctccc acggctgggc ttacggtcat ggcggcacgg cgctgcatgg caaacatttg       300
     ctgtgggcgg tgacgaccgg cggcggggaa agccattttg aaattggtgc gcatccgggc       360
     tttgatgtgc tgtcgcagcc gctacaggcg acggcaatct actgcgggct gaactggctg       420
     ccaccgtttg ccatgcactg cacctttatt tgtgacgacg aaaccctcga agggcaggcg       480
     cgtcactata agcaacgtct gctggaatgg caggaggccc atcatggata g                531
//

If you have problems or comments...

PBIL Back to PBIL home page