(data stored in ACNUC7421 zone)

EMBL: CP000948.MATC

CP000948.MATC        Location/Qualifiers
FT   CDS_pept        complement(284132..284800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="matC"
FT                   /gene_synonym="yagY"
FT                   /locus_tag="ECDH10B_0280"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01458"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR040695"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XE34"
FT                   /protein_id="ACB01458.1"
FT                   /translation="MKKHLLPLALLFSGISPAQALDVGDISSFMNSDSSTLSKTIKNST
FT                   DSGRLINIRLERLSSPLDDGQVISMDKPDELLLTPASLLLPAQASEVIRFFYKGPADEK
FT                   ERYYRIVWFDQALSDAQRDNANRSAVATASARIGTILVVAPRQANYHFQYANGSLTNTG
FT                   NATLRILAYGPCLKAANGKECKENYYLMPGKSRRFTRVDTADNKGRVALWQGDKFIPVK
FT                   "
     atgaaaaagc accttctgcc tctcgctctg ctgttttccg gaatatctcc ggcccaggcg        60
     ctggatgtcg gcgatatatc atcgtttatg aacagtgaca gcagcacgct gagcaaaacg       120
     atcaaaaaca gtaccgacag tggtcgcctt atcaatatcc gtctcgaacg gctctcttca       180
     ccgcttgacg acgggcaggt tatctcaatg gacaagccgg atgagttgct actcactccc       240
     gccagcttgc tgctacccgc ccaagccagc gaagtgatcc gcttcttcta taagggaccc       300
     gcagatgaaa aagagcgcta ctaccgcatt gtctggtttg atcaggccct cagtgatgcg       360
     cagcgcgata atgccaaccg cagcgctgtg gccactgctt ccgcccgcat cggcaccatt       420
     ctggtcgtcg cccctcgtca ggcgaactac cactttcagt acgccaacgg ctccctgaca       480
     aatacaggaa atgcgacgct gcggatcctc gcctacggac cttgcctgaa agccgccaac       540
     ggtaaggagt gtaaagagaa ttactacctg atgccgggca agtcgcgtcg ttttacccgc       600
     gtggacactg cggataacaa aggacgggtt gcactttggc agggtgataa gttcattccc       660
     gtgaaatag                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page