(data stored in ACNUC7421 zone)

EMBL: CP000948.METQ

CP000948.METQ        Location/Qualifiers
FT   CDS_pept        complement(194217..195032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ"
FT                   /locus_tag="ECDH10B_0178"
FT                   /product="receptor component of DL-methionine uptake
FT                   transporter (MUT)"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01376"
FT                   /protein_id="ACB01376.1"
FT                   /translation="MAFKFKTFAAVGALIGSLALVGCGQDEKDPNHIKVGVIVGAEQQV
FT                   AEVAQKVAKDKYGLDVELVTFNDYVLPNEALSKGDIDANAFQHKPYLDQQLKDRGYKLV
FT                   AVGNTFVYPIAGYSKKIKSLDELQDGSQVAVPNDPTNLGRSLLLLQKVGLIKLKDGVGL
FT                   LPTVLDVVENPKNLKIVELEAPQLPRSLDDAQIALAVINTTYASQIGLTPAKDGIFVED
FT                   KESPYVNLIVTREDNKDAENVKKFVQAYQSDEVYEAANKVFNGGAVKGW"
     atggcgttca aattcaaaac ctttgcggca gtgggagccc tgatcggatc actggcactg        60
     gtaggctgcg gtcaggatga aaaagatcca aaccacatta aagtcggcgt gattgttggt       120
     gccgaacagc aggttgcaga agtcgcgcag aaagttgcga aagacaaata tggcctggac       180
     gttgagctgg taaccttcaa cgactatgtt ctgccaaacg aagcattgag caaaggcgat       240
     atcgacgcca acgccttcca gcataaaccg taccttgatc agcaactgaa agatcgtggc       300
     tacaaactgg tcgcagtagg caacactttt gtttatccga ttgctggtta ctccaagaaa       360
     atcaaatcac tggatgaact gcaggatggt tcgcaggttg ccgtgccaaa cgacccaact       420
     aaccttggtc gttcactgct gctgctgcaa aaagtgggct tgatcaaact gaaagatggc       480
     gttggcctgc tgccgaccgt tcttgatgtt gttgagaacc ccaaaaatct gaaaattgtt       540
     gaactggaag caccgcaact gccgcgttct ctggacgacg cgcaaatcgc tctggcagtt       600
     atcaatacca cctatgccag ccagattggc ctgactccgg cgaaagacgg tatctttgtt       660
     gaagataaag agtccccgta cgtaaacctg atcgtgacgc gtgaagataa caaagacgcc       720
     gagaacgtga agaaattcgt ccaggcttat cagtctgacg aagtttacga agcagcaaac       780
     aaagtgttta acggcggagc tgttaaaggc tggtaa                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page