(data stored in ACNUC7421 zone)

EMBL: CP000948.MOKC

CP000948.MOKC        Location/Qualifiers
FT   CDS_pept        complement(16751..16960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mokC"
FT                   /locus_tag="ECDH10B_0017"
FT                   /product="regulatory protein for HokC, overlaps CDS of
FT                   hokC"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01222"
FT                   /protein_id="ACB01222.1"
FT                   /translation="MLNTCRVPLTDRKVKEKRAMKQHKAMIVALIVICITAVVAALVTR
FT                   KDLCEVHIRTGQTEVAVFTAYESE"
     atgctgaaca catgtagagt gcctcttact gaccgtaagg tcaaggagaa gagagcaatg        60
     aagcagcata aggcgatgat tgtcgccctg atcgtcatct gtatcaccgc cgtagtggcg       120
     gcgctggtaa cgagaaaaga cctctgtgag gttcacatcc gaactggcca gacggaggtt       180
     gctgttttca cggcttacga atccgagtaa                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page