(data stored in ACNUC7421 zone)

EMBL: CP000948.MRDA

CP000948.MRDA        Location/Qualifiers
FT   CDS_pept        complement(604871..606772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdA"
FT                   /locus_tag="ECDH10B_0596"
FT                   /product="transpeptidase involved in peptidoglycan
FT                   synthesis (penicillin-binding protein 2)"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01756"
FT                   /protein_id="ACB01756.1"
FT                   /translation="MKLQNSFRDYTAESALFVRRALVAFLGILLLTGVLIANLYNLQIV
FT                   RFTDYQTRSNENRIKLVPIAPSRGIIYDRNGIPLALNRTIYQIEMMPEKVDNVQQTLDA
FT                   LRSVVDLTDDDIAAFRKERARSHRFTSIPVKTNLTEVQVARFAVNQYRFPGVEVKGYKR
FT                   RYYPYGSALTHVIGYVSKINDKDVERLNNDGKLANYAATHDIGKLGIERYYEDVLHGQT
FT                   GYEEVEVNNRGRVIRQLKEVPPQAGHDIYLTLDLKLQQYIETLLAGSRAAVVVTDPRTG
FT                   GVLALVSTPSYDPNLFVDGISSKDYSALLNDPNTPLVNRATQGVYPPASTVKPYVAVSA
FT                   LSAGVITRNTTLFDPGWWQLPGSEKRYRDWKKWGHGRLNVTRSLEESADTFFYQVAYDM
FT                   GIDRLSEWMGKFGYGHYTGIDLAEERSGNMPTREWKQKRFKKPWYQGDTIPVGIGQGYW
FT                   TATPIQMSKALMILINDGIVKVPHLLMSTAEDGKQVPWVQPHEPPVGDIHSGYWELAKD
FT                   GMYGVANRPNGTAHKYFASAPYKIAAKSGTAQVFGLKANETYNAHKIAERLRDHKLMTA
FT                   FAPYNNPQVAVAMILENGGAGPAVGTLMRQILDHIMLGDNNTDLPAENPAVAAAEDH"
     atgaaactac agaactcttt tcgcgactat acggcagagt ccgcgctgtt tgtgcgccgg        60
     gcgctggtcg cctttttggg gattttgctg ctgaccggcg tgcttatcgc caacctgtat       120
     aatctgcaaa ttgttcgctt taccgactac cagacccgct ctaatgaaaa ccgcattaag       180
     ctggtgccta tcgcgcccag ccgcggcatt atctacgatc gtaacggtat ccctctggcc       240
     ctcaaccgca ctatctacca gatagaaatg atgccggaga aagtcgataa cgtgcagcaa       300
     acgctggacg ctttgcgcag cgtggtagat ctgaccgatg acgatattgc tgcattccga       360
     aaagagcgcg cacgttcaca ccgtttcacc tctattccgg tgaaaactaa cctgaccgaa       420
     gtacaagtag ctcgctttgc cgtcaatcag taccgttttc cgggtgtcga agttaaaggc       480
     tataaacgtc gttactatcc ttacggttcg gcgttgaccc acgtcatcgg ctatgtgtcg       540
     aaaatcaacg ataaagacgt cgaacgcctg aataatgacg gcaaactggc caactatgcg       600
     gcaacgcatg atatcggtaa gctgggcatt gagcgttact atgaagatgt gctgcacggt       660
     cagaccggtt atgaagaggt tgaagttaac aaccgtgggc gtgttattcg ccagttaaaa       720
     gaagtaccac cgcaagccgg acacgatatt tacctgacgc tggatctcaa actccagcaa       780
     tatattgaaa cgctgctggc gggtagccgc gcagctgtgg tagtcaccga tccgcgtaca       840
     ggtggggtgc tggcgctggt ttccacgcct agttatgacc caaacttgtt tgttgacggt       900
     atctccagca aagattattc cgccttgttg aacgatccga atacaccgct ggtgaaccgc       960
     gccacacagg gggtttatcc tcccgcgtct acagttaaac cctatgtggc ggtttcggca      1020
     ttgagcgccg gggtgatcac gcgcaatacg acgctgtttg acccaggctg gtggcaactg      1080
     ccaggttcgg aaaaacgtta tcgtgactgg aaaaaatggg gccacgggcg tctgaatgtc      1140
     acaagatcgc tggaagaatc tgcggatacc ttcttctatc aggtggccta cgatatgggg      1200
     atcgatcgcc tctccgaatg gatgggtaaa ttcggttatg gtcattacac cggtatcgac      1260
     ctggcggaag aacgttccgg caacatgcct acccgcgaat ggaaacagaa acgctttaaa      1320
     aaaccgtggt atcagggtga caccattccg gttggtatcg gtcagggtta ctggacagcg      1380
     accccaatcc agatgagtaa ggcactgatg atcctgatta atgacggtat cgtgaaggtt      1440
     cctcatttgc tgatgagcac cgccgaagac ggcaaacagg tgccatgggt acagccgcat      1500
     gaaccgcccg tcggcgatat tcattccggt tactgggagc tggcgaaaga cggtatgtac      1560
     ggtgttgcta accgccctaa cggtacggcg cataaatact ttgctagcgc accgtacaaa      1620
     attgcggcga aatccggtac cgctcaggtc ttcggtctga aagcgaacga aacctataat      1680
     gcgcacaaaa ttgccgagcg tttacgtgac cacaaactga tgaccgcctt tgcgccatac      1740
     aacaatccgc aagtggctgt cgccatgatt ctggagaacg gtggtgcggg tccggcggtt      1800
     ggtacactga tgcgccagat cctcgaccac attatgctgg gtgataacaa caccgatctg      1860
     cctgcggaaa atccagcggt tgccgcagcg gaggaccatt aa                         1902
//

If you have problems or comments...

PBIL Back to PBIL home page