(data stored in ACNUC7421 zone)

EMBL: CP000948.MRDB

CP000948.MRDB        Location/Qualifiers
FT   CDS_pept        complement(603756..604868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdB"
FT                   /locus_tag="ECDH10B_0595"
FT                   /product="cell wall shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01755"
FT                   /protein_id="ACB01755.1"
FT                   /translation="MTDNPNKKTFWDKVHLDPTMLLILLALLVYSALVIWSASGQDIGM
FT                   MERKIGQIAMGLVIMVVMAQIPPRVYEGWAPYLYIICIILLVAVDAFGAISKGAQRWLD
FT                   LGIVRFQPSEIAKIAVPLMVARFINRDVCPPSLKNTGIALVLIFMPTLLVAAQPDLGTS
FT                   ILVALSGLFVLFLSGLSWRLIGVAVVLVAAFIPILWFFLMHDYQRQRVMMLLDPESDPL
FT                   GAGYHIIQSKIAIGSGGLRGKGWLHGTQSQLEFLPERHTDFIFAVLAEELGLVGILILL
FT                   ALYILLIMRGLWIAARAQTTFGRVMAGGLMLILFVYVFVNIGMVSGILPVVGVPLPLVS
FT                   YGGSALIVLMAGFGIVMSIHTHRKMLSKSV"
     atgacggata atccgaataa aaaaacattc tgggataaag tccatctcga tcccacaatg        60
     ctgctgatct tactggcatt gctggtttac agcgccctgg ttatctggag cgccagcggt       120
     caggatattg gcatgatgga gcgtaaaatc ggccaaatcg cgatgggtct ggtcatcatg       180
     gtggtgatgg cgcaaattcc tccacgcgtt tatgaaggct gggcccccta tctctatatc       240
     atctgtatta ttttgctggt ggcggtagat gctttcggtg ccatctctaa aggtgctcaa       300
     cgctggctgg acctcggtat tgttcgtttt cagccgtcgg aaattgccaa aatagccgta       360
     ccactgatgg ttgcgcgctt tatcaaccgc gacgtttgcc cgccatcgtt gaagaacact       420
     ggcatcgcgc tggtgctgat atttatgccc acgctgctgg tggctgcaca gcctgacctg       480
     ggaacatcaa tcctcgttgc gctttccggt ctgtttgtac tgttcctctc tggccttagc       540
     tggcgtctga ttggcgtcgc agtagtgctg gtagcggcgt tcattccgat tctgtggttc       600
     ttcctgatgc atgattacca gcgccagcgc gtaatgatgc tcctggaccc ggaatcagac       660
     ccactcggcg cgggctatca cattattcag tctaaaattg ctattggctc cggcggatta       720
     cgcggcaaag gctggctgca cggcactcag tcacagcttg aatttctccc cgaacgccat       780
     actgacttta tcttcgcggt actggcggaa gagctgggat tagtgggcat tctgattctg       840
     ctcgctctct acattctgct gatcatgcgc gggctgtgga tagccgccag agcgcaaacc       900
     acctttggtc gcgtcatggc tggcggctta atgctgatat tattcgttta tgtcttcgta       960
     aatattggta tggtaagcgg tattctgccg gttgtagggg ttccgctccc actggtcagt      1020
     tatggaggat cggcgctaat tgtgctgatg gctgggttcg ggattgtaat gtcaatccac      1080
     acccacagga aaatgttgtc gaaaagcgtg taa                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page