(data stored in ACNUC7421 zone)

EMBL: CP000948.NAGE

CP000948.NAGE        Location/Qualifiers
FT   CDS_pept        755759..757705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagE"
FT                   /locus_tag="ECDH10B_0744"
FT                   /product="fused N-acetyl glucosamine specific PTS enzyme:
FT                   IIC, IIB , and IIA components"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01890"
FT                   /protein_id="ACB01890.1"
FT                   /translation="MNILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVAFIAQAG
FT                   GAIFDNLALIFAIGVASSWSKDSAGAAALAGAVGYFVLTKAMVTINPEINMGVLAGIIT
FT                   GLVGGAAYNRWSDIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGG
FT                   EWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTVFHGDINRFYAG
FT                   DGTAGMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLE
FT                   FLFMFLAPLLYLLHALLTGISLFVATLLGIHAGFSFSAGAIDYALMYNLPAASQNVWML
FT                   LVMGVIFFAIYFVVFSLVIRMFNLKTPGREDKEDEIVTEEANSNTEEGLTQLATNYIAA
FT                   VGGTDNLKAIDACITRLRLTVADSARVNDTMCKRLGASGVVKLNKQTIQVIVGAKAESI
FT                   GDAMKKVVARGPVAAASAEATPATAAPVAKPQAVPNAVSIAELVSPITGDVVALDQVPD
FT                   EAFASKAVGDGVAVKPTDKIVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVA
FT                   LEGKGFKRLVEEGAQVSAGQPILEMDLDYLNANARSMISPVVCSNIDDFSGLIIKAQGH
FT                   IVAGQTPLYEIKK"
     atgaatattt taggtttttt ccagcgactc ggtagggcgt tacagctccc tatcgcggtg        60
     ctgccggtgg cggcactgtt gctgcgattc ggtcagccag atttacttaa cgttgcgttt       120
     attgcccagg cgggcggtgc gatttttgat aacctcgcat taatcttcgc catcggtgtg       180
     gcatccagct ggtcgaaaga cagcgctggt gcggcggcgc tggcgggtgc ggtaggttac       240
     tttgtgttaa ccaaagcgat ggtgaccatc aacccagaaa ttaacatggg tgtactggcg       300
     ggtatcatta ccggtctggt tggtggcgca gcctataacc gttggtccga tattaaactg       360
     ccggacttcc tgagcttctt cggcggcaaa cgctttgtgc cgattgccac cggattcttc       420
     tgcctggtgc tggcggccat ttttggttac gtctggccgc cggtacagca cgctatccat       480
     gcaggcggcg agtggatcgt ttctgcgggc gcgctgggtt ccggtatctt tggtttcatc       540
     aaccgtctgc tgatcccaac cggtctgcat caggtactga acaccatcgc ctggttccag       600
     attggtgaat tcaccaacgc ggcgggtacg gttttccacg gtgacattaa ccgcttctat       660
     gccggtgacg gcaccgcggg gatgttcatg tccggcttct tcccgatcat gatgttcggt       720
     ctgccgggtg cggcgctggc gatgtacttc gcagcaccga aagagcgtcg tccgatggtt       780
     ggcggtatgc tgctttctgt tgctgttact gcgttcctga ccggtgtgac tgagccgctg       840
     gaattcctgt tcatgttcct tgctccgctg ctgtacctcc tgcacgcact gctgaccggt       900
     atcagcctgt ttgtggcaac gctgctgggt atccacgcgg gcttctcttt ctctgcgggg       960
     gctatcgact acgcgttgat gtataacctg ccggccgcca gccagaacgt ctggatgctg      1020
     ctggtgatgg gcgttatctt cttcgctatc tacttcgtgg tgttcagttt ggttatccgc      1080
     atgttcaacc tgaaaacgcc gggtcgtgaa gataaagaag acgagatcgt tactgaagaa      1140
     gccaacagca acactgaaga aggtctgact caactggcaa ccaactatat tgctgcggtt      1200
     ggcggcactg acaacctgaa agcgattgac gcctgtatca cccgtctgcg ccttacagtg      1260
     gctgactctg cccgcgttaa cgatacgatg tgtaaacgtc tgggtgcttc tggggtagtg      1320
     aaactgaaca aacagactat tcaggtgatt gttggcgcga aagcagaatc catcggcgat      1380
     gcgatgaaga aagtcgttgc ccgtggtccg gtagccgctg cgtcagctga agcaactccg      1440
     gcaactgccg cgcctgtagc aaaaccgcag gctgtaccaa acgcggtatc tatcgcggag      1500
     ctggtatcgc cgattaccgg tgatgtcgtg gcactggatc aggttcctga cgaagcattc      1560
     gccagcaaag cggtgggtga cggtgtggcg gtgaaaccga cagataaaat cgtcgtatca      1620
     ccagccgcag ggacaatcgt gaaaatcttc aacaccaacc acgcgttctg cctggaaacc      1680
     gaaaaaggcg cggagatcgt cgtccatatg ggtatcgaca ccgtagcgct ggaaggtaaa      1740
     ggctttaaac gtctggtgga agagggtgcg caggtaagcg cagggcaacc gattctggaa      1800
     atggatctgg attacctgaa cgctaacgcc cgctcgatga ttagcccggt ggtttgcagc      1860
     aatatcgacg atttcagtgg cttgatcatt aaagctcagg gccatattgt ggcgggtcaa      1920
     acaccgctgt atgaaatcaa aaagtaa                                          1947
//

If you have problems or comments...

PBIL Back to PBIL home page