(data stored in ACNUC7421 zone)

EMBL: CP000948.OMPT

CP000948.OMPT        Location/Qualifiers
FT   CDS_pept        complement(523235..524188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompT"
FT                   /locus_tag="ECDH10B_0523"
FT                   /product="DLP12 prophage; outer membrane protease VII
FT                   (outer membrane protein 3b)"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01686"
FT                   /protein_id="ACB01686.1"
FT                   /translation="MRAKLLGIVLTTPIAISSFASTETLSFTPDNINADISLGTLSGKT
FT                   KERVYLAEEGGRKVSQLDWKFNNAAIIKGAINWDLMPQISIGAAGWTTLGSRGGNMVDQ
FT                   DWMDSSNPGTWTDESRHPDTQLNYANEFDLNIKGWLLNEPNYRLGLMAGYQESRYSFTA
FT                   RGGSYIYSSEEGFRDDIGSFPNGERAIGYKQRFKMPYIGLTGSYRYEDFELGGTFKYSG
FT                   WVESSDNDEHYDPGKRITYRSKVKDQNYYSVAVNAGYYVTPNAKVYVEGAWNRVTNKKG
FT                   NTSLYDHNNNTSDYSKNGAGIENYNFITTAGLKYTF"
     atgcgggcga aacttctggg aatagtcctg acaaccccta ttgcgatcag ctcttttgct        60
     tctaccgaga ctttatcgtt tactcctgac aacataaatg cggacattag tcttggaact       120
     ctgagcggaa aaacaaaaga gcgtgtttat ctagccgaag aaggaggccg aaaagtcagt       180
     caactcgact ggaaattcaa taacgctgca attattaaag gtgcaattaa ttgggatttg       240
     atgccccaga tatctatcgg ggctgctggc tggacaactc tcggcagccg aggtggcaat       300
     atggtcgatc aggactggat ggattccagt aaccccggaa cctggacgga tgaaagtaga       360
     caccctgata cacaactcaa ttatgccaac gaatttgatc tgaatatcaa aggctggctc       420
     ctcaacgaac ccaattaccg cctgggactc atggccggat atcaggaaag ccgttatagc       480
     tttacagcca gaggtggttc ctatatctac agttctgagg agggattcag agatgatatc       540
     ggctccttcc cgaatggaga aagagcaatc ggctacaaac aacgttttaa aatgccctac       600
     attggcttga ctggaagtta tcgttatgaa gattttgaac tcggtggcac atttaaatac       660
     agcggctggg tggaatcatc tgataacgat gaacactatg acccgggaaa aagaatcact       720
     tatcgcagta aggtcaaaga ccaaaattac tattctgttg cagtcaatgc aggttattac       780
     gtcacaccta acgcaaaagt ttatgttgaa ggcgcatgga atcgggttac gaataaaaaa       840
     ggtaatactt cactttatga tcacaataat aacacttcag actacagcaa aaatggagca       900
     ggtatagaaa actataactt catcactact gctggtctta agtacacatt ttaa             954
//

If you have problems or comments...

PBIL Back to PBIL home page