(data stored in ACNUC7421 zone)

EMBL: CP000948.PE602

CP000948.PE602       Location/Qualifiers
FT   CDS_pept        631695..631901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcW"
FT                   /locus_tag="ECDH10B_0625"
FT                   /product="DLP12 prophage; predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01784"
FT                   /protein_id="ACB01784.1"
FT                   /translation="MNKEQSADDPSVDLIRVKNMLNSTISMSYPDVVIACIEHKVSLEA
FT                   FRAIEAALVKHDNNMKDYSLVVD"
     atgaataaag aacaatctgc tgatgatccc tccgtggatc tgattcgtgt aaaaaatatg        60
     cttaatagca ccatttctat gagttaccct gatgttgtaa ttgcatgtat agaacataag       120
     gtgtctctgg aagcattcag ggcaattgag gcagcgttgg tgaagcacga taataatatg       180
     aaggattatt ccctggtggt tgactga                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page