(data stored in ACNUC7421 zone)

EMBL: CP000948.PE603

CP000948.PE603       Location/Qualifiers
FT   CDS_pept        632649..633194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nohB"
FT                   /locus_tag="ECDH10B_0626"
FT                   /product="DLP12 prophage; DNA packaging protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01785"
FT                   /protein_id="ACB01785.1"
FT                   /translation="MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAA
FT                   VIKWYAERDAEIENEKLRREVEELLQASETDLQPGTIEYERHRLTRAQADAQELKNARD
FT                   SAEVVETAFCTFVLSRIAGEIASILDGIPLSVQRRFPELENRHVDFLKRDIIKAMNKAA
FT                   ALDELIPGLLSEYIEQSG"
     atggaagtca acaaaaagca gctggctgac attttcggtg cgagtatccg taccattcag        60
     aactggcagg aacagggaat gcccgttctg cgaggcggtg gcaagggtaa tgaggtgctt       120
     tatgactctg ccgccgtcat aaaatggtat gccgaaaggg atgctgaaat tgagaacgaa       180
     aagctgcgcc gggaggttga agaactgctg caggccagcg agacagatct ccagccaggg       240
     actattgagt acgaacgcca tcgacttacg cgtgcgcagg ccgatgcaca ggagctgaaa       300
     aatgccagag actccgctga agtggtggaa accgcattct gtactttcgt gctgtcgcgg       360
     atcgcaggtg aaattgccag tattctcgac gggatccccc tgtcggtgca gcggcgtttt       420
     ccggaactgg aaaaccgaca tgttgatttc ctgaaacggg atatcatcaa agccatgaac       480
     aaagcagccg cgctggatga actgataccg gggttgctga gtgaatatat cgaacagtca       540
     ggttaa                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page