(data stored in ACNUC7421 zone)

EMBL: CP000948.PE612

CP000948.PE612       Location/Qualifiers
FT   CDS_pept        complement(642756..644993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfrB"
FT                   /locus_tag="ECDH10B_0635"
FT                   /product="bacteriophage N4 receptor, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01791"
FT                   /protein_id="ACB01791.1"
FT                   /translation="MDWLLDVFATWLYGLKVIAITLAVIMFISGLDDFFIDVVYWVRRI
FT                   KRKLSVYRRYPRMSYRELYKPDEKPLAIMVPAWNETGVIGNMAELAATTLDYENYHIFV
FT                   GTYPNDPDTQRDVDEVCARFPNVHKVVCARPGPTSKADCLNNVLDAITQFERSANFAFA
FT                   GFILHDAEDVISPMELRLFNYLVERKDLIQIPVYPFEREWTHFTSMTYIDEFSELHGKD
FT                   VPVREALAGQVPSAGVGTCFSRRAVTALLADGDGIAFDVQSLTEDYDIGFRLKEKGMTE
FT                   IFVRFPVVDEAKEREQRKFLQHARTSNMICVREYFPDTFSTAVRQKSRWIIGIVFQGFK
FT                   THKWTSSLTLNYFLWRDRKGAISNFVSFLAMLVMIQLLLLLAYESLWPDAWHFLSIFSG
FT                   SAWLMTLLWLNFGLMVNRIVQRVIFVTGYYGLTQGLLSVLRLFWGNLINFMANWRALKQ
FT                   VLQHGDPRRVAWDKTTHDFPSVTGDTRSLRPLGQILLENQVITEEQLDTALRNRVEGLR
FT                   LGGSMLMQGLISAEQLAQALAEQNGVAWESIDAWQIPSSLIAEMPASVALHYAVLPLRL
FT                   ENDELIVGSEDGIDPVSLAALTRKVGRKVRYVIVLRGQIVTGLRHWYARRRGHDPRAML
FT                   YNAVQHQWLTEQQAGEIWRQYVPHQFLFAEILTTLGHINRSAINVLLLRHERSSLPLGK
FT                   FLVTEGVISQETLDRVLTIQRELQVSMQSLLLKAGLNTEQVAQLESENEGE"
     gtggactggc ttcttgatgt ttttgctacc tggctctacg gcttaaaagt aatcgcgata        60
     acgttagcgg tcatcatgtt catcagcggg ctggacgatt tttttattga tgtcgtctac       120
     tgggtacgcc gcattaaacg caagttgagt gtttatcgcc gctacccgcg aatgagttac       180
     cgcgaactgt ataaaccaga tgaaaaaccg ttagcgatta tggttccggc gtggaatgaa       240
     acgggcgtca tcggcaatat ggccgagctg gcggcgacca cgctcgacta cgaaaactat       300
     catatctttg ttggcaccta ccccaacgac cccgatactc agcgtgatgt tgacgaagtg       360
     tgcgctcgct tcccgaatgt gcataaggta gtctgcgcgc gtcctggccc caccagcaaa       420
     gccgactgtc tgaacaacgt gctggacgcc atcacccaat ttgagcgtag cgccaatttc       480
     gcttttgctg gttttattct gcatgacgcc gaagatgtga tttcaccgat ggaattgcgt       540
     ctgttcaact atctggtcga gcgtaaagat ctgattcaga tcccggtgta tccgttcgaa       600
     cgcgaatgga cgcacttcac cagcatgact tacattgatg agttttcaga gctgcatggc       660
     aaagatgttc cggtgcgtga agccctcgcc ggacaagtgc ccagcgcagg cgtcggcacc       720
     tgtttcagcc gccgcgccgt gaccgcactg ttagctgacg gtgacggtat tgctttcgac       780
     gtgcagagtc ttactgaaga ttacgacatt ggcttccgcc tgaaagaaaa aggtatgacg       840
     gaaatttttg tccgttttcc ggtggtggac gaagccaaag aacgcgagca gcgtaaattt       900
     ttacagcacg cgcggacatc aaacatgatc tgcgtgcgcg aatatttccc cgataccttt       960
     tcgactgcgg ttcgacaaaa atcccgctgg atcatcggca ttgttttcca aggctttaaa      1020
     acccataaat ggacctccag cctgacgctg aactactttc tctggcgcga ccgcaaaggg      1080
     gcaatcagta actttgtcag cttcctcgcg atgctggtga tgatccagct tttgctgttg      1140
     ctggcgtatg aaagtttgtg gcccgatgcc tggcatttcc tttctatttt cagcggcagc      1200
     gcatggttaa tgaccctgct gtggctaaac tttggtttga tggttaaccg catcgtgcag      1260
     cgggtgattt tcgttactgg ctactacggc ctgacgcagg ggctgctttc cgtcctgcgt      1320
     cttttctggg gcaacctgat taacttcatg gccaactggc gcgcgctaaa acaggtactt      1380
     caacacggcg atccacgtcg cgtggcgtgg gataaaacaa cgcatgactt ccccagcgtg      1440
     actggcgata cccgctcgtt gcgcccgtta ggtcaaattc tgctggaaaa tcaggtcatc      1500
     actgaagaac aactcgatac agcactgcgt aatcgcgtcg aaggtctacg cctgggcggt      1560
     tcaatgctga tgcaggggct gattagcgcc gagcagctgg cacaggcgct ggcagagcaa      1620
     aacggcgtgg cgtgggaatc catcgatgcc tggcagatcc cttcctcgct gattgccgaa      1680
     atgccggcct ccgtggcgct gcattatgcg gtactgccgc tgcgtctgga aaatgacgag      1740
     ttaattgtcg gcagtgaaga tggtattgac ccggtttcgc tggcggccct gacgcgtaaa      1800
     gtcggacgca aagtgcgtta cgtcattgtt ctgcggggac aaattgtcac agggttacgt      1860
     cactggtatg cacgccgacg cggtcacgat ccgcgggcaa tgttgtacaa tgcggttcag      1920
     catcagtggc tcacggaaca gcaggccggt gaaatctggc ggcaatatgt gccgcatcag      1980
     ttcctgttcg ccgaaatact gaccacgctc ggtcatatta atcgttcagc aattaacgtg      2040
     ttgttattgc gccatgaacg cagttctctg ccgctcggca agtttttggt caccgaaggc      2100
     gttatcagcc aggaaacgtt ggatcgcgtc ctgacaattc aacgcgaatt acaagtttcg      2160
     atgcaatcac tattactcaa agcaggttta aacacagaac aggttgcgca actggagtcc      2220
     gaaaatgaag gagaataa                                                    2238
//

If you have problems or comments...

PBIL Back to PBIL home page