(data stored in ACNUC7421 zone)

EMBL: CP000948.PE622

CP000948.PE622       Location/Qualifiers
FT   CDS_pept        complement(657333..657701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdF"
FT                   /locus_tag="ECDH10B_0645"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01801"
FT                   /protein_id="ACB01801.1"
FT                   /translation="MDKQSLHETAKRLALELPFVELCWPFGPEFDVFKIGGKIFMLSSE
FT                   LRGVPFINLKSDPQKSLLNQQIYPSIKPGYHMNKKHWISVYPGEEISEALLRDLINDSW
FT                   NLVVDGLAKRDQKRVRPG"
     atggataagc aatcactgca cgaaacggcg aaacgcctgg cccttgagtt accctttgtc        60
     gagctttgct ggccttttgg cccggagttc gatgttttta aaattggcgg caagattttt       120
     atgctgtcgt cggagctacg cggcgtcccc tttatcaatc tgaagtccga tccacaaaaa       180
     tccctgttaa atcagcaaat atacccaagc attaagccag ggtatcacat gaataaaaag       240
     cactggattt cagtgtatcc cggcgaagaa atctccgaag cgttacttcg cgatctgatc       300
     aacgattcgt ggaatctggt ggttgatggt ctggctaaac gcgatcaaaa aagagtgcgt       360
     ccaggctaa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page