(data stored in ACNUC7421 zone)

EMBL: CP000948.PE634

CP000948.PE634       Location/Qualifiers
FT   CDS_pept        complement(672011..673003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepG"
FT                   /locus_tag="ECDH10B_0657"
FT                   /product="iron-enterobactin transporter subunit; membrane
FT                   component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01813"
FT                   /protein_id="ACB01813.1"
FT                   /translation="MIYVSRRLLITCLLLVSACVVAGIWGLRSGAVTLETSQVFAALMG
FT                   DAPRSMTMVVTEWRLPRVLMALLIGAALGVSGAIFQSLMRNPLGSPDVMGFNTGAWSGV
FT                   LVAMVLFGQDLTAIALSAMVGGIVTSLLVWLLAWRNGIDTFRLIIIGIGVRAMLVAFNT
FT                   WLLLKASLETALTAGLWNAGSLNGLTWAKTSPSAPIIILMLIAAALLVRRMRLLEMGDD
FT                   TACALGVSVERSRLLMMLVAVVLTAAATALAGPISFIALVAPHIARRISGTARWGLTQA
FT                   ALCGALLLLAADLCAQQLFMPYQLPVGVVTVSLGGIYLIVLLIQESRKK"
     atgatttacg tctctcgccg attactcatc acctgtttgc tgctggtttc cgcctgtgtg        60
     gttgcaggta tctggggatt acgcagcggt gccgtcacgc tggaaacctc gcaggtattc       120
     gccgcgctga tgggcgatgc gccgcgcagt atgacgatgg tggtcaccga atggcgttta       180
     ccacgcgtgc tgatggcgct gttgattggc gcagcactgg gcgtcagtgg cgcgattttt       240
     cagtcgctga tgcgtaaccc gctcggcagc cctgacgtaa tgggctttaa caccggggcg       300
     tggagcggcg tgctggtggc gatggtgctg tttggtcagg acctgacggc tatcgcgctg       360
     tcagcaatgg tgggcggcat tgtcacttcg ctgctggtct ggctgctcgc ctggcgcaac       420
     ggcatcgaca cctttcggtt gattattatc ggtatcggcg ttcgcgccat gctggtggcc       480
     tttaatacct ggctgttgct gaaagcgtct ttagaaacgg cgctaacagc aggtttgtgg       540
     aatgccggat cgctcaacgg cctgacgtgg gcaaaaacct cgccttccgc acccatcatt       600
     atattgatgc tcattgccgc cgccttactg gtacgccgga tgcgcttgct ggaaatgggc       660
     gatgataccg cgtgtgcgct gggcgtcagc gtcgaacgtt cgcgtctgtt aatgatgctg       720
     gttgcagtgg tgcttaccgc tgcggcaaca gcgcttgccg ggccgatttc ctttattgct       780
     ttagtcgcac cgcacattgc ccgacgcatt agcggcaccg ctcgctgggg gctaacccag       840
     gcggcgctat gcggggcgct gttactgctg gcggccgatc tctgcgccca acaactgttt       900
     atgccgtatc aacttccggt tggcgtcgtt accgtcagcc tcggcggtat ttaccttatc       960
     gtcttgttaa ttcaggagtc tcgcaaaaaa tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page