(data stored in ACNUC7421 zone)

EMBL: CP000948.PE637

CP000948.PE637       Location/Qualifiers
FT   CDS_pept        complement(675369..676325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepB"
FT                   /locus_tag="ECDH10B_0660"
FT                   /product="iron-enterobactin transporter subunit;
FT                   periplasmic-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01816"
FT                   /protein_id="ACB01816.1"
FT                   /translation="MRLAPLYRNALLLTGLLLSGIAAVQAADWPRQITDSRGTHTLESQ
FT                   PQRIVSTSVTLTGSLLAIDAPVIASGATTPNNRVADDQGFLRQWSKVAKERKLQRLYIG
FT                   EPSAEAVAAQMPDLILISATGGDSALALYDQLSTIAPTLIINYDDKSWQSLLTQLGEIT
FT                   GHEKQAAERIAQFDKQLAAAKEQIKLPPQPVTAIVYTAAAHSANLWTPESAQGQMLEQL
FT                   GFTLAKLPAGLNASQSQGKRHDIIQLGGENLAAGLNGESLFLFAGDQKDADAIYANPLL
FT                   AHLPAVQNKQVYALGTETFRLDYYSAMQVLDRLKALF"
     gtgagactcg ccccgctcta ccgcaacgcc cttctattaa caggactttt gctttcagga        60
     atagccgcag ttcaggccgc tgactggccg cgtcagatta ctgacagccg tggcacacat       120
     acactggaaa gccagccgca gcgtattgtt tccaccagcg tcaccctgac cggctcactg       180
     ctggcgattg atgctccggt gatcgccagc ggcgcgacca cgccgaataa ccgcgtcgcg       240
     gatgaccagg gctttttacg ccagtggagc aaggtggcga aagaacgcaa actgcaacgg       300
     ctctatatcg gcgaaccgag cgccgaagcc gttgccgcgc aaatgccgga tctgatttta       360
     attagcgcaa ccggcgggga ttcggcgctg gcactgtatg atcagctttc caccatcgcc       420
     ccgacattaa tcatcaatta cgacgacaaa agctggcagt cgctgttaac gcaacttggc       480
     gaaattaccg ggcatgagaa acaagcggca gagcggattg cgcagtttga taagcaactg       540
     gcggcggcga aagagcaaat caaattaccg ccgcagccgg tcactgccat tgtctatact       600
     gccgctgcac acagtgccaa tctctggacg ccagaatcag cacaagggca gatgctggaa       660
     caactcggct ttacgctggc gaagttaccc gcagggttaa atgccagcca aagtcagggt       720
     aaacgccatg acatcattca gcttggtggg gaaaatctgg ctgcagggtt aaatggcgag       780
     tcactattcc tgttcgccgg tgatcagaaa gatgccgatg ctatttatgc taatccgctg       840
     ctcgcgcacc tgcctgcagt acaaaacaag caggtttatg cgctgggaac cgagacgttc       900
     cgtctggatt actacagcgc catgcaagtg ctggataggc ttaaggcgct gttttaa          957
//

If you have problems or comments...

PBIL Back to PBIL home page