(data stored in ACNUC7421 zone)

EMBL: CP000948.PE648

CP000948.PE648       Location/Qualifiers
FT   CDS_pept        complement(687164..688384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdN"
FT                   /locus_tag="ECDH10B_0671"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01827"
FT                   /protein_id="ACB01827.1"
FT                   /translation="MSIYKIPLPLNILEAARERITWTLNTLPRVCVSFSGGKDSGLMLH
FT                   LTAELARQMGKKICVLFIDWEAQFSCTINYVQSLRELYTDVIEEFYWVALPLTTQNSLS
FT                   QYQPEWQCWEPDVEWVRQPPQDAITDPDFFCFYQPGMTFEQFVREFAEWFSQKRPAAMM
FT                   IGIRADESYNRFVAIASLNKQRFADDKPWTTAAPGGHSWYIYPIYDWKVADIWTWYANH
FT                   QSLCNPLYNLMYQAGVPLRHMRICEPFGPEQRQGLWLYHVIEPDRWAAMCARVSGVKSG
FT                   GIYAGHDNHFYGHRKILKPEHLDWQEYALLLLNSMPEKTAEHYRNKIAIYLHWYQKKGI
FT                   EVPQTQQGDIGAKDIPSWRRICKVLLNNDYWCRALSFSPTKSKNYQRYNERIKGKRQEW
FT                   GILCNND"
     atgtctattt ataaaattcc tcttccgctc aatattctgg aagctgcacg agagcgtatt        60
     acctggacac tcaacaccct accccgcgtt tgtgtctcat tttctggcgg caaagactct       120
     ggtttaatgc tgcatctgac agccgaactt gcccgacaaa tgggcaaaaa aatctgcgtt       180
     ttgtttatcg actgggaggc gcaattctct tgcaccatta actatgttca gtccctgcgc       240
     gagttgtaca ccgatgtcat cgaagagttt tactgggttg cgctcccgct tacgacgcaa       300
     aattcccttt cacaatacca acccgaatgg cagtgctggg aacctgatgt cgaatgggta       360
     cgtcaacctc cccaagatgc gataaccgac cctgactttt tctgctttta ccagccaggc       420
     atgaccttcg aacaatttgt acgtgagttt gccgaatggt tttcacaaaa acgtccggcg       480
     gcgatgatga tcggcatccg tgcggatgag tcctacaacc gttttgtcgc catcgccagt       540
     ttaaataaac aacgttttgc cgacgataaa ccctggacta cggccgcacc aggcggtcat       600
     agctggtaca tttaccccat ttacgactgg aaagtggctg atatctggac ctggtatgca       660
     aatcatcaaa gtctctgcaa cccactgtat aacctaatgt atcaggcagg cgttcctctg       720
     cgtcatatgc gaatttgcga accttttggc ccggagcaac gacaaggatt atggctctat       780
     cacgttatcg aaccggatcg ctgggctgct atgtgcgcac gagtcagcgg ggtaaaaagt       840
     ggcggcattt acgccggaca tgacaatcat ttctatgggc atcggaaaat cctcaagcca       900
     gaacatttag actggcaaga atatgcatta ttgctgctca atagcatgcc ggaaaaaaca       960
     gctgagcatt accgcaataa aatcgccatt tatttgcact ggtatcagaa aaaaggcatc      1020
     gaggttccac aaacccagca aggggacatt ggcgcgaaag atatcccctc ctggcggcgg      1080
     atatgcaaag ttttactcaa taacgattac tggtgtcggg cattatcatt tagccccaca      1140
     aaatcgaaga actatcagcg ttataacgaa cggataaaag gaaaacgtca ggaatggggg      1200
     atactatgca acaacgatta a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page