(data stored in ACNUC7421 zone)

EMBL: CP000948.PE652

CP000948.PE652       Location/Qualifiers
FT   CDS_pept        691568..693133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="ECDH10B_0675"
FT                   /product="alkyl hydroperoxide reductase, F52a subunit,
FT                   FAD/NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01831"
FT                   /protein_id="ACB01831.1"
FT                   /translation="MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAE
FT                   LSDKVTFKEDNSLPVRKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKE
FT                   AQSLLEQIRHIDGDFEFETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEI
FT                   TDRNVMGVPAVFVNGKEFGQGRMTLTEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGP
FT                   AGAAAAIYSARKGIRTGLMGERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVDEYD
FT                   VDVIDSQSASKLIPAAVEGGLHQIETASGAVLKARSIIVATGAKWRNMNVPGEDQYRTK
FT                   GVTYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDK
FT                   LRSLKNVDIILNAQTTEVKGDGSKVVGLEYRDRVSGDIHNIELAGIFVQIGLLPNTNWL
FT                   EGAVERNRMGEIIIDAKCETNVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIR
FT                   TKTA"
     atgctcgaca caaatatgaa aactcaactc aaggcttacc ttgagaaatt gaccaagcct        60
     gttgagttaa ttgccacgct ggatgacagc gctaaatcgg cagaaatcaa ggaactgttg       120
     gctgaaatcg cagaactgtc agacaaagtc acctttaaag aagataacag cttgccggtg       180
     cgtaagccgt ctttcctgat caccaaccca ggttccaacc aggggccacg ttttgcaggc       240
     tccccgctgg gccacgagtt cacctcgctg gtactggcgt tgctgtggac cggtggtcat       300
     ccgtcgaaag aagcgcagtc tctgctggag cagattcgcc atattgacgg tgattttgaa       360
     ttcgaaacct attactcgct ctcttgccac aactgcccgg acgtggtgca ggcgctgaac       420
     ctgatgagcg tactgaaccc gcgcatcaag cacactgcaa ttgacggcgg caccttccag       480
     aacgaaatca ccgatcgcaa cgtgatgggc gttccggcag tgttcgtaaa cgggaaagag       540
     tttggtcagg gccgcatgac gttgactgaa atcgttgcca aaattgatac tggcgcggaa       600
     aaacgtgcgg cagaagagct gaacaagcgt gatgcttatg acgtattaat cgtcggttcc       660
     ggcccggcgg gtgcagcggc agcaatttac tccgcacgta aaggcatccg taccggtctg       720
     atgggcgaac gttttggtgg tcagatcctc gataccgttg atatcgaaaa ctacatttct       780
     gtaccgaaga ctgaagggca gaagctggca ggcgcactga aagttcacgt tgatgaatac       840
     gacgttgatg tgatcgacag ccagagcgcc agcaaactga tcccagcagc agttgaaggt       900
     ggtctgcatc agattgaaac agcttctggc gcggtactga aagcacgcag cattatcgtg       960
     gcgaccggtg caaaatggcg caacatgaac gttccgggcg aagatcagta tcgcaccaaa      1020
     ggcgtgacct actgcccgca ctgcgacggc ccgctgttta aaggtaaacg cgtagcggtt      1080
     atcggcggcg gtaactccgg cgtggaagcg gcaattgacc tggcgggtat cgttgagcac      1140
     gtaacgctgc tggaatttgc gccagaaatg aaagccgacc aggttctgca ggacaaactg      1200
     cgcagcctga aaaacgtcga cattattctg aatgcgcaaa ccacggaagt gaaaggcgac      1260
     ggcagcaaag tcgttggtct ggaatatcga gatcgtgtca gcggcgatat tcacaacatc      1320
     gaactggccg gtattttcgt ccagattggt ctgctgccga acaccaactg gctcgaaggc      1380
     gcagtcgaac gtaaccgcat gggcgagatt atcattgatg cgaaatgcga aaccaacgtg      1440
     aaaggcgtgt tcgcagcggg tgactgtacg acggttccgt acaagcagat catcatcgcc      1500
     actggcgaag gtgccaaagc ctctctgagt gcttttgact acctgattcg caccaaaact      1560
     gcataa                                                                 1566
//

If you have problems or comments...

PBIL Back to PBIL home page