(data stored in ACNUC7421 zone)

EMBL: CP000948.PE660

CP000948.PE660       Location/Qualifiers
FT   CDS_pept        complement(699854..701386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citF"
FT                   /locus_tag="ECDH10B_0683"
FT                   /product="citrate lyase, citrate-ACP transferase (alpha)
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01839"
FT                   /protein_id="ACB01839.1"
FT                   /translation="MTQKIEQSQRQERVAAWNRRAECDLAAFQNSPKQTYQAEKARDRK
FT                   LCANLEEAIRRSGLQDGMTVSFHHAFRGGDLTVNMVMDVIAKMGFKNLTLASSSLSDCH
FT                   APLVEHIRQGVVTRIYTSGLRGPLAEEISRGLLAEPVQIHSHGGRVHLVQSGELNIDVA
FT                   FLGVPSCDEFGNANGYTGKACCGSLGYAIVDADNAKQVVMLTEELLPYPHNPASIEQDQ
FT                   VDLIVKVDRVGDAAKIGAGATRMTTNPRELLIARSAADVIVNSGYFKEGFSMQTGTGGA
FT                   SLAVTRFLEDKMRSRDIRADFALGGITATMVDLHEKGLIRKLLDVQSFDSHAAQSLARN
FT                   PNHIEISANQYANWGSKGASVDRLDVVVLSALEIDTQFNVNVLTGSDGVLRGASGGHCD
FT                   TAIASALSIIVAPLVRGRIPTLVDNVLTCITPGSSVDILVTDHGIAVNPARPELAERLQ
FT                   EAGIKVVSIEWLRERARLLTGEPQPIEFTDRVVAVVRYRDGSVIDVVHQVKE"
     atgacgcaga aaattgaaca atctcaacga caagaacggg tagcggcctg gaatcgtcgc        60
     gctgaatgcg atcttgccgc tttccagaac tcgccaaagc aaacctacca ggctgaaaaa       120
     gcgcgcgatc gcaaactgtg cgccaacctg gaagaagcga ttcgtcgctc tggtttacag       180
     gacggcatga cggtttcctt ccatcacgct ttccgtggcg gtgacctgac cgtcaatatg       240
     gtgatggacg tcatcgcgaa gatgggcttt aaaaacctga ccctggcgtc cagctccctg       300
     agtgattgcc atgcgccgct ggtagaacac attcgccagg gcgtggttac ccgcatttat       360
     acctccggcc tgcgtggtcc actggcggaa gagatctccc gtggtctgct ggcagaaccg       420
     gtgcagatcc actctcacgg cggtcgtgtg catctggtac agagcggcga actgaatatc       480
     gacgtggctt tcctcggcgt cccgtcctgt gatgaattcg gtaatgccaa cggctacacc       540
     ggtaaagcct gctgcggctc cctcggctat gcaatagttg atgccgacaa cgcaaaacag       600
     gtcgtgatgc ttaccgaaga actgctgcct tatccgcata atccggcaag cattgagcaa       660
     gatcaggttg atttgatcgt caaagttgac cgcgttggcg atgctgcaaa aatcggcgct       720
     ggcgcgaccc gtatgaccac taacccgcgc gaactgctta ttgcccgtag cgctgcggat       780
     gtgattgtca actctggcta cttcaaagaa ggtttctcca tgcaaaccgg caccggcggc       840
     gcatcgctgg cggtaacccg tttcctggaa gacaaaatgc gtagccgcga tattcgcgcc       900
     gacttcgccc ttggcggtat taccgcgacg atggttgacc tgcacgaaaa aggtctgatc       960
     cgcaaactgc tggatgtgca gagctttgac agccatgctg cgcaatcgct ggcccgtaac      1020
     cccaatcaca tcgaaatcag cgccaaccag tacgctaact ggggttcgaa aggcgcatcg      1080
     gttgatcgtc tcgacgtggt ggtactgagc gcgctggaaa ttgacaccca gttcaacgtt      1140
     aacgtgctga ccggctctga cggcgtactg cgtggtgctt ccggtggtca ctgcgatacc      1200
     gcgattgcct ctgcgctttc catcatcgtc gcgccgctgg tacgcggtcg tattccgact      1260
     ctggtggata acgtactgac ctgcatcacc ccaggctcca gtgtcgatat tctggtcaca      1320
     gaccacggta tcgcagttaa cccggcacgt ccggaactgg cagaacgtct gcaggaagcg      1380
     ggcattaaag tggtttccat tgagtggctg cgcgaacgtg cgcgtctgct gaccggtgaa      1440
     ccacagccga ttgaattcac agaccgcgtc gttgccgttg tgcgttaccg cgatggctcg      1500
     gtgatcgatg ttgtgcatca ggtgaaggaa taa                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page