(data stored in ACNUC7421 zone)

EMBL: CP000948.PE661

CP000948.PE661       Location/Qualifiers
FT   CDS_pept        complement(701397..702305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /locus_tag="ECDH10B_0684"
FT                   /product="citrate lyase, citryl-ACP lyase (beta) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01840"
FT                   /protein_id="ACB01840.1"
FT                   /translation="MISASLQQRKTRTRRSMLFVPGANAAMVSNSFIYPADALMFDLED
FT                   SVALREKDTARRMVYHALQHPLYRDIETIVRVNALDSEWGVNDLEAVVRGGADVVRLPK
FT                   TDTAQDVLDIEKEILRIEKACGREPGSTGLLAAIESPLGITRAVEIAHASERLIGIALG
FT                   AEDYVRNLRTERSPEGTELLFARCSILQAARSAGIQAFDTVYSDANNEAGFLQEAAHIK
FT                   QLGFDGKSLINPRQIDLLHNLYAPTQKEVDHARRVVEAAEAAAREGLGVVSLNGKMVDG
FT                   PVIDRARLVLSRAELSGIREE"
     atgatttccg cttcgctgca acaacgtaaa actcgcaccc gccgcagcat gttgtttgtg        60
     cctggtgcca atgccgcgat ggtcagcaac tccttcatct acccggctga tgccctgatg       120
     tttgacctcg aagactccgt agcattgcgt gaaaaagaca ccgcccgccg catggtttac       180
     cacgcgctgc aacatccgct gtatcgcgat attgaaacca ttgtgcgtgt caacgcgctg       240
     gattccgaat ggggtgttaa cgacctggaa gccgtcgttc gcggtggtgc ggacgttgtg       300
     cgtctgccga aaaccgatac cgctcaggat gttctggata ttgaaaaaga gatcctgcgt       360
     atcgaaaaag cctgtggtcg tgaacccggc agcaccggcc tgctggcggc gattgaatct       420
     ccgctgggga ttacccgcgc agtggaaatc gctcacgctt ccgagcgttt gatcggtatc       480
     gccctcggtg cagaagacta tgtgcgcaac ctgcgtacag aacgctcccc ggaaggaact       540
     gaactgctgt tcgcacgctg ttccattttg caggccgcgc gctctgcggg tattcaggcg       600
     ttcgataccg tctattccga cgctaacaac gaagccggat ttctgcaaga agccgcccac       660
     atcaaacagc tgggctttga cggcaaatcg ctgatcaacc cgcgtcagat tgatctgctg       720
     cacaacctct acgcaccgac ccagaaagaa gtggatcacg cccgccgcgt cgtagaagcc       780
     gctgaagccg ccgctcgcga aggcctcggc gtggtttccc tgaacggcaa gatggtggac       840
     ggtccggtta tcgatcgcgc ccgtctggtg ctctcccgtg cagaactttc cggcatccgc       900
     gaagaataa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page