(data stored in ACNUC7421 zone)

EMBL: CP000948.PE687

CP000948.PE687       Location/Qualifiers
FT   CDS_pept        726833..727315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeL"
FT                   /locus_tag="ECDH10B_0712"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01865"
FT                   /protein_id="ACB01865.1"
FT                   /translation="MNKVAQYYRELVASLSERLRNGERDIDALVEQARERVIKTGELTR
FT                   TEVDELTRAVRRDLEEFAMSYEESLKEESDSVFMRVIKESLWQELADITDKTQLEWREV
FT                   FQDLNHHGVYHSGEVVGLGNLVCEKCHFHLPIYTPEVLTLCPKCGHDQFQRRPFEP"
     atgaacaagg ttgctcaata ttaccgtgaa ctggttgcgt cactgagcga acgcctgcgc        60
     aatggcgaac gtgatatcga cgcactggtg gaacaggcgc gcgagcgcgt aataaaaaca       120
     ggggagttaa cgcgaaccga ggtcgatgag ctgacgcgag ctgtcagacg tgacctggaa       180
     gagttcgcca tgagctatga agagagcctg aaagaagaat ctgacagcgt ctttatgcgg       240
     gtgattaaag aaagcttgtg gcaggagctg gcagacatca ccgataaaac gcagcttgaa       300
     tggcgcgaag ttttccagga cctcaatcat catggggttt atcacagcgg agaagtggtc       360
     gggctgggaa atctggtctg cgagaaatgt cacttccatc tcccgatcta cacaccggaa       420
     gtgctgacgc tatgcccgaa atgtggtcat gaccagttcc agagacgccc gtttgagccg       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page