(data stored in ACNUC7421 zone)

EMBL: CP000948.PE689

CP000948.PE689       Location/Qualifiers
FT   CDS_pept        728526..729233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeR"
FT                   /locus_tag="ECDH10B_0714"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01867"
FT                   /protein_id="ACB01867.1"
FT                   /translation="MDMESQKILFALSTPMEIRNECCLPSHSSPKMYLGTCFFDLSSSW
FT                   GIDDRDDLLRTIHRMIDNGHAARLAGFYHRWFRYSPCEWRDYLAELNEQGQAYAQFVAS
FT                   TAECCGEGGIKAWDYVRMGFLSRMGVLNNWLSEEESLWIQSRIHLRALRYYSNWRQYFA
FT                   GYTFGRQYWQSPEDDHLPLLREFLARKEYDDSGNDMFYQLFASDDAYYPTLSWQPLAYY
FT                   SACPETLKDMSDL"
     atggacatgg agtcgcaaaa aatattgttt gcactttcca ctccgatgga aatacgcaat        60
     gaatgctgtt taccttcgca ttcatcaccc aaaatgtatt taggtacatg cttttttgac       120
     ctttcttcct catggggaat tgatgaccgt gatgacctgc tgcgcacaat tcaccgaatg       180
     atcgataacg gtcatgccgc tcggttggca gggttttatc accgctggtt tcgttattcg       240
     ccatgtgaat ggcgtgacta tcttgctgaa ctaaatgagc aaggtcaggc ttatgcgcaa       300
     tttgtcgcca gcaccgccga atgctgtggc gaagggggaa tcaaagcctg ggattatgtc       360
     cggatgggtt ttttaagccg aatgggcgta cttaataact ggttgagcga agaagaaagt       420
     ctatggatcc agtcgcgcat tcatctacgg gctctacgtt attatagtaa ctggcggcaa       480
     tactttgccg gttatacctt tggtcggcaa tattggcagt ctcccgaaga tgatcatctg       540
     cctttattac gcgaattctt agcgcgtaaa gaatacgacg attccggcaa tgatatgttt       600
     tatcaattat ttgccagtga tgatgcgtat taccctacct tgtcctggca accattggct       660
     tactattctg catgcccgga aacgcttaag gatatgagcg acctatga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page