(data stored in ACNUC7421 zone)

EMBL: CP000948.PE696

CP000948.PE696       Location/Qualifiers
FT   CDS_pept        complement(736345..737070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltL"
FT                   /locus_tag="ECDH10B_0721"
FT                   /product="glutamate and aspartate transporter subunit,
FT                   ATP-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01874"
FT                   /protein_id="ACB01874.1"
FT                   /translation="MITLKNVSKWYGHFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIK
FT                   TVNGLEPVQQGEITVDGIVVNDKKTDLAKLRSRVGMVFQHFELFPHLSIIENLTLAQVK
FT                   VLKRDKAPAREKALKLLERVGLSAHANKFPAQLSGGQQQRVAIARALCMDPIAMLFDEP
FT                   TSALDPEMINEVLDVMVELANEGMTMMVVTHEMGFARKVANRVIFMDEGKIVEDSPKDA
FT                   FFDDPKSDRAKDFLAKILH"
     atgattaccc tgaaaaatgt ttcaaaatgg tatggtcact ttcaggtgct gaccgactgc        60
     tcaaccgaag tgaaaaaagg cgaagtggtg gtggtttgcg gcccgtctgg ttccggcaaa       120
     tcaacgctga ttaaaaccgt caacggcctc gaaccggtgc agcaaggtga aatcaccgtc       180
     gatggtatcg tggttaacga caagaaaacc gatctggcaa agctgcgttc ccgcgtcggg       240
     atggtattcc agcatttcga gctgttccct catctgtcga ttatcgaaaa cctgaccctg       300
     gcgcaggtga aagtgcttaa acgcgataaa gcgccggctc gtgaaaaagc cctgaaactg       360
     ctggagcgtg tcgggctttc tgctcacgcc aataagtttc cggcgcagct ttccggcggt       420
     cagcagcagc gtgtggcaat cgctcgcgcg ttgtgtatgg atcctattgc gatgctgttt       480
     gacgaaccga catcggcgct ggatccggag atgatcaacg aagtactgga cgtgatggtg       540
     gaactggcga acgaaggaat gaccatgatg gtggtgaccc acgaaatggg ctttgcccgt       600
     aaagtggcga atcgggtgat ctttatggac gagggtaaaa ttgtcgaaga ctcgccgaaa       660
     gacgctttct tcgatgatcc gaaatcggac cgcgcaaaag acttcctcgc gaaaatcctg       720
     cattaa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page