(data stored in ACNUC7421 zone)

EMBL: CP000948.PE697

CP000948.PE697       Location/Qualifiers
FT   CDS_pept        complement(737070..737744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltK"
FT                   /locus_tag="ECDH10B_0722"
FT                   /product="glutamate and aspartate transporter subunit,
FT                   membrane component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01875"
FT                   /protein_id="ACB01875.1"
FT                   /translation="MYEFDWSSIVPSLPYLLDGLVITLKITVTAVVIGILWGTMLAVMR
FT                   LSSFAPVAWFAKAYVNVFRSIPLVMVLLWFYLIVPGFLQNVLGLSPKNDIRLISAMVAF
FT                   SMFEAAYYSEIIRAGIQSISRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGI
FT                   VLFQDTSLVYVLSLADFFRTASTIGERDGTQVEMILFAGFVYFVISLSASLLVSYLKRR
FT                   TA"
     atgtacgagt ttgactggag ttccattgtc ccttccctgc catatctgct cgacgggctg        60
     gtgatcaccc tgaaaatcac cgtcacggcg gtagtgattg gtattttgtg gggcacgatg       120
     ctggcggtga tgcgtttatc cagctttgcg cccgtggcgt ggtttgccaa agcctacgtt       180
     aacgtattcc gctcgattcc tttagttatg gttttgctgt ggttttacct gatcgtgccg       240
     ggttttctgc aaaacgtgct gggattatcg ccaaaaaatg atatccgttt aatttcggcg       300
     atggtggcgt tttcgatgtt tgaagcggcc tactattcag agattatccg tgctggtatt       360
     caaagtattt ctcgtggtca atcgagcgcc gcgctggcgt tgggaatgac tcactggcag       420
     tcgatgaaac tgattattct gccgcaggcg ttccgcgcga tggtgccgct gctgctcact       480
     cagggcatcg tactgttcca ggatacctca ctggtgtatg tgttatccct ggccgatttc       540
     ttccgtaccg cctcaaccat tggtgagcgt gatggtacgc aggttgagat gatcctgttt       600
     gccggatttg tttatttcgt tattagtctt agcgcgtcgt tgttggtcag ctacttgaaa       660
     agaaggacag cataa                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page