(data stored in ACNUC7421 zone)

EMBL: CP000948.PE698

CP000948.PE698       Location/Qualifiers
FT   CDS_pept        complement(737744..738484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltJ"
FT                   /locus_tag="ECDH10B_0723"
FT                   /product="glutamate and aspartate transporter subunit;
FT                   membrane component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01876"
FT                   /protein_id="ACB01876.1"
FT                   /translation="MSIDWNWGIFLQQAPFGNTTYLGWIWSGFQVTIALSICAWIIAFL
FT                   VGSFFGILRTVPNRFLSGLGTLYVELFRNVPLIVQFFTWYLVIPELLPEKIGMWFKAEL
FT                   DPNIQFFLSSMLCLGLFTAARVCEQVRAAIQSLPRGQKNAALAMGLTLPQAYRYVLLPN
FT                   AYRVIVPPMTSEMMNLVKNSAIASTIGLVDMAAQAGKLLDYSAHAWESFTAITLAYVLI
FT                   NAFIMLVMTLVERKVRLPGNMGGK"
     atgtctatag actggaactg gggtattttt ttacaacaag ccccgttcgg caacaccacc        60
     tatcttggtt ggatctggag tggttttcag gtgacgatcg ctttgtcgat ctgcgcctgg       120
     attatcgctt tcctcgtcgg ttcatttttc ggcattttac gtaccgttcc aaaccgtttt       180
     ctctctggtc tgggtacgtt gtatgtcgaa ctgttccgca acgtgccgtt gattgtgcaa       240
     ttctttacct ggtatctggt gatcccggag ctgctgccgg agaaaatcgg catgtggttt       300
     aaggccgagc tggatcccaa tattcagttt ttcctttcat ccatgctctg cctggggctg       360
     tttaccgccg cccgtgtttg cgaacaggta cgcgccgcga ttcagtcgct gccgcgaggg       420
     caaaaaaatg ccgcgctggc gatgggcctg acgctaccgc aggcttatcg atacgtactg       480
     ctgcctaatg cttatcgcgt tatcgtcccg ccgatgacct cagagatgat gaacctggtg       540
     aaaaactccg ccatcgcctc gactatcggt ctggtggata tggcggcgca ggcgggtaaa       600
     ttgctcgatt actcagccca tgcctgggag tcgtttaccg ccattacgct ggcgtatgtg       660
     ttgattaacg cttttatcat gctggtgatg acgctggttg aacgtaaagt tcgcctgcct       720
     ggcaacatgg ggggcaaata a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page