(data stored in ACNUC7421 zone)

EMBL: CP000948.PE699

CP000948.PE699       Location/Qualifiers
FT   CDS_pept        complement(738654..739562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltI"
FT                   /locus_tag="ECDH10B_0724"
FT                   /product="glutamate and aspartate transporter subunit,
FT                   periplasmic-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01877"
FT                   /protein_id="ACB01877.1"
FT                   /translation="MQLRKPATAILALALSAGLAQADDAAPAAGSTLDKIAKNGVIVVG
FT                   HRESSVPFSYYDNQQKVVGYSQDYSNAIVEAVKKKLNKPDLQVKLIPITSQNRIPLLQN
FT                   GTFDFECGSTTNNVERQKQAAFSDTIFVVGTRLLTKKGGDIKDFANLKDKAVVVTSGTT
FT                   SEVLLNKLNEEQKMNMRIISAKDHGDSFRTLESGRAVAFMMDDALLAGERAKAKKPDNW
FT                   EIVGKPQSQEAYGCMLRKDDPQFKKLMDDTIAQVQTSGEAEKWFDKWFKNPIPPKNLNM
FT                   NFELSDEMKALFKEPNDKALN"
     atgcaattac gtaaacctgc cacagcaatc ctcgccctgg cgctttccgc aggactggca        60
     caggcagatg acgccgcccc ggcagcgggc agtactctgg acaaaatcgc caaaaacggt       120
     gtgattgtcg tcggtcaccg tgaatcttca gtgcctttct cttattacga caatcagcaa       180
     aaagtggtgg gttactcgca ggattactcc aacgccattg ttgaagcagt gaaaaagaaa       240
     ctcaacaaac cggacttgca ggtaaaactg attccgatta cctcacaaaa ccgtattcca       300
     ctgctgcaaa acggcacttt cgattttgaa tgtggttcta ccaccaacaa cgtcgaacgc       360
     caaaaacagg cggctttctc tgacactatt ttcgtggtcg gtacgcgcct gttgaccaaa       420
     aagggtggcg atatcaaaga ttttgccaac ctgaaagaca aagccgtagt cgtcacttcc       480
     ggcactacct ctgaagtttt gctcaacaaa ctgaatgaag agcaaaaaat gaatatgcgc       540
     atcatcagcg ccaaagatca cggtgactct ttccgcaccc tggaaagcgg tcgtgccgtt       600
     gcctttatga tggatgacgc tctgctggcc ggtgaacgtg cgaaagcgaa gaaaccagac       660
     aactgggaaa tcgtcggcaa gccgcagtct caggaggcct acggttgtat gttgcgtaaa       720
     gatgatccgc agttcaaaaa gctgatggat gacaccatcg ctcaggtgca gacctccggt       780
     gaagcggaaa aatggtttga taagtggttc aaaaatccaa ttccgccgaa aaacctgaac       840
     atgaatttcg aactgtcaga cgaaatgaaa gcactgttca aagaaccgaa tgacaaggca       900
     ctgaactaa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page