(data stored in ACNUC7421 zone)

EMBL: CP000948.PSIF

CP000948.PSIF        Location/Qualifiers
FT   CDS_pept        341836..342156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psiF"
FT                   /locus_tag="ECDH10B_0341"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01513"
FT                   /protein_id="ACB01513.1"
FT                   /translation="MKITLLVTLLFGLVFLTTVGAAERTLTPQQQRMTSCNQQATAQAL
FT                   KGDARKTYMSDCLKNSKSAPGEKSLTPQQQKMRECNNQATQQSLKGDDRNKFMSACLKK
FT                   AA"
     atgaaaataa cattactggt taccttgctt ttcggtctgg tttttttaac caccgtcggc        60
     gctgccgaga gaactttaac cccacaacaa cagcgtatga cctcctgtaa tcagcaggcg       120
     acggcgcagg cgttgaaagg ggatgctcgt aagacctaca tgagtgattg cctgaagaac       180
     agcaagtctg cgcctggcga aaaaagtttg acgccacagc agcaaaagat gcgcgaatgc       240
     aataatcaag caacacaaca atctctgaaa ggtgatgatc gtaataagtt tatgagtgcc       300
     tgcctcaaga aagccgcctg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page