(data stored in ACNUC7421 zone)

EMBL: CP000948.QUEC

CP000948.QUEC        Location/Qualifiers
FT   CDS_pept        complement(403407..404102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queC"
FT                   /locus_tag="ECDH10B_0400"
FT                   /product="enzyme in preQ0 biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01572"
FT                   /db_xref="GOA:B1XFN2"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XFN2"
FT                   /protein_id="ACB01572.1"
FT                   /translation="MKRAVVVFSGGQDSTTCLVQALQQYDEVHCVTFDYGQRHRAEIDV
FT                   ARELALKLGARAHKVLDVTLLNELAVSSLTRDSIPVPDYEPEADGIPNTFVPGRNILFL
FT                   TLAAIYAYQVKAEAVITGVCETDFSGYPDCRDEFVKALNHAVSLGMAKDIRFETPLMWI
FT                   DKAETWALADYYGKLDLVRNETLTCYNGFKGDGCGHCAACNLRANGLNHYLADKPTVMA
FT                   AMKQKTGLR"
     atgaaacgtg ctgtcgttgt gttcagtgga ggtcaggatt ccaccacctg tctggtgcag        60
     gcattacaac aatatgatga agtccattgc gtgacgttcg attacggtca gcggcatcgc       120
     gcagaaatcg acgtggcacg cgaactggcg ctgaaactgg gggcacgcgc gcataaggtg       180
     ctggatgtca ccctgctcaa cgagctggcg gtcagtagcc tgacgcgtga cagcattccg       240
     gtgcctgatt atgaacctga agccgatggt atcccgaata cgtttgtccc agggcgtaat       300
     attttgttcc tgacgctggc ggcaatatat gcgtatcagg taaaagcaga agccgtaatt       360
     actggcgtct gcgaaacgga tttctccggc tacccggatt gccgcgatga gtttgtgaaa       420
     gcactaaacc atgccgtcag tttgggcatg gcgaaagata ttcgttttga aacgccgctg       480
     atgtggattg ataaagcgga aacctgggcg ctggcagatt attacggcaa actggattta       540
     gtccgtaacg aaacgttgac ctgctataac ggctttaaag gcgacggttg cggtcattgt       600
     gcggcatgta atttacgcgc caacggtttg aatcattatc tggccgataa accgacggtg       660
     atggcagcga tgaagcagaa aaccgggttg aggtaa                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page