(data stored in ACNUC7421 zone)

EMBL: CP000948.RCSF

CP000948.RCSF        Location/Qualifiers
FT   CDS_pept        complement(193695..194099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsF"
FT                   /locus_tag="ECDH10B_0177"
FT                   /product="predicted outer membrane protein, signal"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01375"
FT                   /protein_id="ACB01375.1"
FT                   /translation="MRALPICLVALMLSGCSMLSRSPVEPVQSTAPQPKAEPAKPKAPR
FT                   ATPVRIYTNAEELVGKPFRDLGEVSGDSCQASNQDSPPSIPTARKRMQINASKMKANAV
FT                   LLHSCEVTSGTPGCYRQAVCIGSALNITAK"
     atgcgtgctt taccgatctg tttagtagca ctcatgctaa gcggctgttc catgttaagc        60
     agatcccctg tcgaacccgt tcaaagcact gcaccccagc cgaaagcgga gcctgcaaaa       120
     ccgaaagcgc cgcgcgccac gccggtccga atttatacca atgcagaaga attagtcggc       180
     aaaccgttcc gcgatctcgg tgaagtcagt ggcgactctt gccaggcctc taatcaggac       240
     tctccgccga gcattccaac cgcacgtaag cggatgcaaa tcaacgcctc taaaatgaaa       300
     gccaatgctg tattactgca tagctgcgaa gtcaccagcg gtacgccagg ctgctatcgt       360
     caggctgtat gtatcggttc tgcgcttaac attacggcga aatga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page