(data stored in ACNUC7421 zone)

EMBL: CP000948.RDGC

CP000948.RDGC        Location/Qualifiers
FT   CDS_pept        complement(347663..348574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="ECDH10B_0350"
FT                   /product="DNA-binding protein, non-specific"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01522"
FT                   /db_xref="GOA:B1XEY2"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XEY2"
FT                   /protein_id="ACB01522.1"
FT                   /translation="MLWFKNLMVYRLSREISLRAEEMEKQLASMAFTPCGSQDMAKMGW
FT                   VPPMGSHSDALTHVANGQIVICARKEEKILPSPVIKQALEAKIAKLEAEQARKLKKTEK
FT                   DSLKDEVLHSLLPRAFSRFSQTMMWIDTVNGLIMVDCASAKKAEDTLALLRKSLGSLPV
FT                   VPLSMENPIELTLTEWVRSGSAAQGFQLLDEAELKSLLEDGGVIRAKKQDLTSEEITNH
FT                   IEAGKVVTKLALDWQQRIQFVMCDDGSLKRLKFCDELRDQNEDIDREDFAQRFDADFIL
FT                   MTGELAALIQNLIEGLGGEAQR"
     atgctgtggt tcaaaaattt aatggtttac cgtcttagcc gcgagatttc gctgcgtgca        60
     gaagagatgg aaaaacagct agcctcgatg gcatttaccc catgcggcag ccaggacatg       120
     gcgaagatgg gctgggttcc tccgatggga tcgcacagcg atgcgttaac gcacgttgcc       180
     aatggtcaaa ttgttatctg cgcgcgcaaa gaagaaaaaa tcctcccgtc tccggtgatt       240
     aaacaggcgc tggaagcgaa aatcgccaaa ctggaagcgg aacaggcgcg taagctgaag       300
     aaaaccgaaa aagattcgct gaaagacgaa gtgctgcact ctctgctgcc gcgtgctttc       360
     agccgtttta gccagacaat gatgtggatc gacacggtta acggtttgat tatggtggac       420
     tgcgccagtg ccaaaaaagc ggaagatacg ctggcattac tgcgtaaaag cctggggtcg       480
     ttaccggttg taccattgag catggaaaac ccgattgaac tgacgctgac cgaatgggtt       540
     cgctccggta gtgcggcaca gggcttccag ctgcttgatg aagccgagct gaaatcgttg       600
     ctggaagatg gcggcgtgat ccgcgcgaag aaacaagatc tgaccagcga agagatcacc       660
     aatcacattg aagccggaaa agtggtgact aaactggcgc tcgactggca gcagcgcatt       720
     cagtttgtga tgtgcgacga tggttcgctc aagcgtctga agttctgcga cgagctgcgc       780
     gatcaaaacg aagatatcga ccgtgaagat ttcgcccagc gttttgatgc cgatttcatc       840
     ctgatgactg gtgaactggc agcgttaatt caaaacctga ttgaaggatt aggtggcgaa       900
     gcacaacgtt aa                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page